SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC2G2.14 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    30   0.58 
SPAC2G11.10c |||URM1 activating enzyme |Schizosaccharomyces pomb...    29   0.76 
SPAPB1A11.03 |||FMN dependent dehydrogenase|Schizosaccharomyces ...    29   0.76 
SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase Ppk30|Schizos...    29   1.0  
SPCC825.01 |||ribosome biogenesis ATPase, Arb family |Schizosacc...    29   1.0  
SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb...    27   3.1  
SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit ...    27   3.1  
SPBP8B7.20c |||RNA methyltransferase Nop2 |Schizosaccharomyces p...    27   3.1  
SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchang...    27   3.1  
SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|...    27   3.1  
SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|S...    27   5.4  
SPBPB2B2.10c |||galactose-1-phosphate uridylyltransferase |Schiz...    27   5.4  
SPBC15D4.01c ||SPBC2D10.21c|kinesin-like protein|Schizosaccharom...    26   7.1  
SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|ch...    26   7.1  
SPCC338.17c |rad21||kleisin|Schizosaccharomyces pombe|chr 3|||Ma...    26   7.1  
SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe...    26   7.1  
SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Ma...    26   9.4  
SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces po...    26   9.4  

>SPBC2G2.14 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 533

 Score = 29.9 bits (64), Expect = 0.58
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 35  GIIENVEREETIEPELSDTLSDAVPINVVD--PITNNHINLK 154
           G+I+N+E  + I  E SDTL + + IN ++     N++ NLK
Sbjct: 280 GLIQNLEDSDDIHEESSDTLEEPLLINELNRTSFLNSNNNLK 321


>SPAC2G11.10c |||URM1 activating enzyme |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 401

 Score = 29.5 bits (63), Expect = 0.76
 Identities = 12/20 (60%), Positives = 12/20 (60%)
 Frame = +1

Query: 676 YTNNPTYRTSCPNPTPTGAS 735
           Y N P YR   PNPTP  AS
Sbjct: 178 YCNGPCYRCMFPNPTPVVAS 197


>SPAPB1A11.03 |||FMN dependent dehydrogenase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 407

 Score = 29.5 bits (63), Expect = 0.76
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +3

Query: 396 WPKNLNQHQPLEMILKSKIKMTRIGTLVVVLDTLLKG 506
           WP N   HQ + + L ++ K T    L+V LDT + G
Sbjct: 161 WPSN--DHQDITISLLNRAKKTGCRVLIVTLDTFILG 195


>SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase
           Ppk30|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 953

 Score = 29.1 bits (62), Expect = 1.0
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 4/68 (5%)
 Frame = +2

Query: 683 TTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEI----RDVQTRLTDLPDES 850
           T+LP  P VQT     P +N  + ++    +SN +   L  I     DV  RL   P   
Sbjct: 371 TSLPPIPTVQTTSSNVPPVNRPSLKSKSPSVSNILSNQLSPISSANNDVMARLQ--PKSP 428

Query: 851 LEATEEVS 874
           + AT+  S
Sbjct: 429 IPATKSYS 436


>SPCC825.01 |||ribosome biogenesis ATPase, Arb family
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 822

 Score = 29.1 bits (62), Expect = 1.0
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 3/41 (7%)
 Frame = +2

Query: 737 INETTRR---TPKDDLSNDIETLLVEIRDVQTRLTDLPDES 850
           INE  R+      +DL +D +   VE+  +QTRLTDL  E+
Sbjct: 355 INEQERKHLEAMMEDLLDDPDKNAVELDTIQTRLTDLETEN 395


>SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1018

 Score = 27.5 bits (58), Expect = 3.1
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +2

Query: 737 INETTRRTPKDDLSNDIETLLVE-IRDVQTRLTDLPDESLEATEEVSRRESNFNQ 898
           IN+  RR  KD+L+N+ E  L E I+ + +  +D P   L     VS   S F +
Sbjct: 240 INQLNRRRTKDNLTNNPEISLDEPIKALPSTTSDAPSSLLNT--NVSSSPSKFRK 292


>SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit
           Bdp1 |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 507

 Score = 27.5 bits (58), Expect = 3.1
 Identities = 23/87 (26%), Positives = 32/87 (36%)
 Frame = +2

Query: 614 ETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIET 793
           E  +  L  N     A  + D      + PVVQT   +E   N T     KDD     E 
Sbjct: 24  EEKNQPLTGNEVETSAQLSRDTANADISSPVVQTVVHKEATENPTASSYRKDDSVKQNEK 83

Query: 794 LLVEIRDVQTRLTDLPDESLEATEEVS 874
           LL      +     + ++ L A E +S
Sbjct: 84  LLHSNPTFKISKPTVLEQPLNAIEHLS 110


>SPBP8B7.20c |||RNA methyltransferase Nop2 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 608

 Score = 27.5 bits (58), Expect = 3.1
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = +2

Query: 614 ETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIET 793
           E  S  LD  AE  +  A E++ T +  E     PP     I+  T   P   L  D+  
Sbjct: 139 EAMSRKLDEEAELEEKEAEEELHTNIHPEAPTVLPP-----IDGFTDSQPISTLPQDLSQ 193

Query: 794 LLVEIRDVQTRLTD 835
           + + I+++   L D
Sbjct: 194 IQLRIQEIVRVLND 207


>SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchange
           factor Sec73 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1082

 Score = 27.5 bits (58), Expect = 3.1
 Identities = 23/109 (21%), Positives = 52/109 (47%), Gaps = 1/109 (0%)
 Frame = +2

Query: 554 SMDLPGGICSWKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEP 733
           S+D  GG  + ++ +  LSAE+ +  L  N     +    D+   + + PVV+ PP+Q  
Sbjct: 185 SLDKAGGPLNQQNEN--LSAESDNTILQ-NGTRKSSVKMSDLGKRIASLPVVKRPPIQFS 241

Query: 734 AINETTRRTPKDDLSNDIETLLVEIRDVQT-RLTDLPDESLEATEEVSR 877
             ++  +   K D ++++ +    +  ++  R   +P++  +   + SR
Sbjct: 242 ISSDYIKPVDKSDQTSNVPSPSSSVGSLRLYRSPSIPNDVEQPQPQSSR 290


>SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large
            subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1752

 Score = 27.5 bits (58), Expect = 3.1
 Identities = 10/27 (37%), Positives = 16/27 (59%)
 Frame = +1

Query: 673  GYTNNPTYRTSCPNPTPTGASHQRDNP 753
            GY+ +P Y  S P+ +PT  S+   +P
Sbjct: 1564 GYSTSPAYMPSSPSYSPTSPSYSPTSP 1590


>SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein
           Klp6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 784

 Score = 26.6 bits (56), Expect = 5.4
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 620 PSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQE 730
           P +++D N E+L A A + ++  +P+EP +Q P L E
Sbjct: 601 PGNAIDVN-ESL-ARAFDQLVGIVPSEPTIQVPNLIE 635


>SPBPB2B2.10c |||galactose-1-phosphate uridylyltransferase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 369

 Score = 26.6 bits (56), Expect = 5.4
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = -3

Query: 608 SSKSYDLSNYIYRRVSPWTDTW 543
           +SK +D + Y +RR +P TD++
Sbjct: 2   TSKKFDFTEYSHRRYNPLTDSY 23


>SPBC15D4.01c ||SPBC2D10.21c|kinesin-like
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 633

 Score = 26.2 bits (55), Expect = 7.1
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 3/60 (5%)
 Frame = +2

Query: 764 KDDLSNDIETLL-VE--IRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAED 934
           +D+ S   ET+  +E  I ++   L  L +ES++   E S  + N NQ +RSSR +  ED
Sbjct: 504 QDENSEKTETIAQLEQIIEELHEELRSLEEESIK---ESSATQQNENQHKRSSRKLLYED 560


>SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 178

 Score = 26.2 bits (55), Expect = 7.1
 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%)
 Frame = +2

Query: 584 WKDHSSYLSAETPSDSLDSNAEA-LQASATEDILTTLPTEPVVQTPPLQEPAINE 745
           W  ++     E     L  N E  L     ED  T    E VV   PLQ   INE
Sbjct: 46  WLTYADKCVIELSKSELKPNEEKELPKDIKEDCKTVEEKEKVVPRKPLQSEGINE 100


>SPCC338.17c |rad21||kleisin|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 628

 Score = 26.2 bits (55), Expect = 7.1
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 6/80 (7%)
 Frame = +2

Query: 644 AEALQASATEDILTTLPTEPVVQ----TPPLQEPAINETTRRTPKDDLSNDIETLLVEIR 811
           A A  A+ TE  + TLP E VVQ     P L  P     T     DD   D   ++++  
Sbjct: 475 AAAELANITEAAIATLPQETVVQPEGEAPELGSPMGFPVTALESADDSLFDAPPVMLDEA 534

Query: 812 DV--QTRLTDLPDESLEATE 865
           D+    RL     E+L +++
Sbjct: 535 DLLGSERLDSSVSEALPSSQ 554


>SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 716

 Score = 26.2 bits (55), Expect = 7.1
 Identities = 10/33 (30%), Positives = 19/33 (57%)
 Frame = -2

Query: 387 KYWHSASWYKCFSTQNLLSLRMFSMSTFTSVFK 289
           +Y++ A WYK   +QN +S+ M   +   ++ K
Sbjct: 154 QYFNLARWYKFMDSQNAVSVTMEEFTKAVNISK 186


>SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 629

 Score = 25.8 bits (54), Expect = 9.4
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = -2

Query: 366 WYKCFSTQNLLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGGVLSFLSFC*TNNNSASS 187
           W++ F T     + +F  S F   FK+ S   +     F    ++S L F    +     
Sbjct: 555 WWRSFITPGFCGIYVFIFSVFYWFFKISSSSLATAVLYFGYSLLISVLVFFLCGSVGFFG 614

Query: 186 VAYLFIQKL 160
            A+LF+ K+
Sbjct: 615 -AFLFVNKI 622


>SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 508

 Score = 25.8 bits (54), Expect = 9.4
 Identities = 15/65 (23%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +2

Query: 767 DDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHG-- 940
           D L + +  +L  +   Q  L     +  + +E  ++ + N N ++    A+GAE  G  
Sbjct: 21  DSLKSVLNDVLSSLERFQVDLDVATSDIYKVSERSNKIQVNLNNLKAVESALGAEIDGAI 80

Query: 941 VPPEV 955
           +PP++
Sbjct: 81  LPPDL 85


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,553,845
Number of Sequences: 5004
Number of extensions: 69482
Number of successful extensions: 295
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 262
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 295
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 507285244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).