SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC2F7.02c |||phosphoprotein phosphatase|Schizosaccharomyces po...   135   5e-33
SPBC3B8.10c |||NLI interacting factor family|Schizosaccharomyces...    73   5e-14
SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subuni...    41   2e-04
SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces p...    36   0.006
SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130 |S...    28   1.2  
SPAC23D3.06c |nup146||nucleoporin Nup146|Schizosaccharomyces pom...    28   1.5  
SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr ...    26   4.7  
SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pomb...    26   6.2  
SPAC1952.16 |rga9||RhoGAp, GTPase activator towards Rho/Rac/Cdc4...    26   6.2  

>SPAC2F7.02c |||phosphoprotein phosphatase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 325

 Score =  135 bits (327), Expect = 5e-33
 Identities = 64/106 (60%), Positives = 81/106 (76%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETLVHSSFK I  A FVV +EIDG  H V V+KRP VDEFL++ G+++  V
Sbjct: 157 KKCLILDLDETLVHSSFKYIEPADFVVSIEIDGLQHDVRVVKRPGVDEFLKKMGDMFEIV 216

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTASLAKYADPV D+LD   V R RLFR++C  + GN+VKDL+ L
Sbjct: 217 VFTASLAKYADPVLDMLDHSHVIRHRLFREACCNYEGNFVKDLSQL 262


>SPBC3B8.10c |||NLI interacting factor family|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 476

 Score = 72.5 bits (170), Expect = 5e-14
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 4/108 (3%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-SFKPINNAHFVVPVEIDGAVHQV--YVLKRPHVDEFLRRCGELY 574
           +  +V+DLDETL+HS S      +   + V + G  H +  Y+ KRPH+D FL    + +
Sbjct: 303 RKTLVLDLDETLIHSVSRGSRTTSGQPIEVHVPGE-HPILYYIHKRPHLDYFLSNVSQWF 361

Query: 575 *CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLN 715
             +LFTAS+  YADP+ D L+R   +F  R +R  C     ++VKD++
Sbjct: 362 RLILFTASVQPYADPIIDYLERDKKIFAKRYYRQHCALVDSSFVKDIS 409


>SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subunit
           Tim50 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 452

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGV-FRARLFRDSCVFHRGNYV 703
           KRP +D FL      Y  V+FT      A P+ D +D + V   A L R+S  + +G  +
Sbjct: 202 KRPGLDYFLGYLSMYYEVVIFTRQYLATAKPIIDKIDPYHVSISAVLTRESSKYEKGKVI 261

Query: 704 KDLNSL 721
           KDL+ L
Sbjct: 262 KDLSYL 267


>SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 723

 Score = 35.9 bits (79), Expect = 0.006
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 17/104 (16%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPI--------NNAHFVVPVEI---------DGAVHQVYVLKRPHV 541
           +++DLD+T++H++  P          N ++ V  ++          G     Y+  RP +
Sbjct: 167 LIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRSFNLQEGPSGYTSCYYIKFRPGL 226

Query: 542 DEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRD 673
            +FL++  ELY   ++T     YA  VA ++D  G    +LF+D
Sbjct: 227 AQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTG----KLFQD 266


>SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1206

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +1

Query: 157  VQHNEGDGTPVSGSTPLGGKKSSGTGGFLR 246
            + H E DG P++  TP  G+  +G G FLR
Sbjct: 930  ISHTEIDGIPMA-LTPFQGRMLAGVGRFLR 958


>SPAC23D3.06c |nup146||nucleoporin Nup146|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1325

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 19/78 (24%), Positives = 36/78 (46%)
 Frame = +1

Query: 19  FTETLSPFVLRPKTNV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGS 198
           + + +S  +  P+ NV  D +   T  + ++E +    PD+ +SP V++     +P S S
Sbjct: 428 YADAISKSIDYPEMNVIKDKNKDSTVRASNNENIPT--PDKQASPFVKNLSSTSSPFSQS 485

Query: 199 TPLGGKKSSGTGGFLRSL 252
           +  G  K      F + L
Sbjct: 486 SAFGNFKFGQATSFDKGL 503


>SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 791

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 17/75 (22%), Positives = 33/75 (44%)
 Frame = -3

Query: 239 KPPVPLDFFPPKGVDPETGVPSPSLCCTPGDEPLSGP*LFNCSSSRDT*VIMDDASIYTF 60
           +P +P      +   P T   SPS+     ++P S P  FN   S +   I+D+ +++  
Sbjct: 460 RPMMPQQSNNSEASIPSTTPQSPSVVSNGENKPSSSPVFFNGPVSSEKEPILDNFNVFKN 519

Query: 59  VFGLNTNGDRVSVKF 15
           V   +   +++   F
Sbjct: 520 VGEEHQGAEQIDKPF 534


>SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 504

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -3

Query: 209 PKGVDPETGVPSPSLCCTPGDEPLSG 132
           P  VDP   + SPSL  + G EP+ G
Sbjct: 52  PNSVDPSASITSPSL--SSGPEPVYG 75


>SPAC1952.16 |rga9||RhoGAp, GTPase activator towards
           Rho/Rac/Cdc42-like small GTPases|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 684

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 10/46 (21%), Positives = 24/46 (52%)
 Frame = +2

Query: 395 TCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKR 532
           TC   + +++  ++L+ SSF     A +    + +   H++Y +K+
Sbjct: 514 TCSLRLCLLEFPDSLIRSSFYDYFKAIYTTYTDFEDLDHRLYSIKK 559


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,939,285
Number of Sequences: 5004
Number of extensions: 61322
Number of successful extensions: 141
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 140
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 337208592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).