SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0042
         (619 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce...    27   1.6  
SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protei...    27   1.6  
SPAC57A7.06 |||U3 snoRNP protein Utp14 |Schizosaccharomyces pomb...    27   2.2  
SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomy...    26   5.0  
SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual    26   5.0  
SPBC4B4.08 |ght2||hexose transporter Ght2 |Schizosaccharomyces p...    25   8.8  
SPAC1687.17c |||Der1-like |Schizosaccharomyces pombe|chr 1|||Manual    25   8.8  
SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc...    25   8.8  
SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Sc...    25   8.8  

>SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 2310

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = -1

Query: 241 RHNYFSAPRRAPVTYTTVKGPMQFFSCIICEVFLTSK 131
           R NYF   +R P  + +  G + F  C++  +  TS+
Sbjct: 486 RENYFKLKKRDPQQFRSASGRLGFMVCLLEILSFTSR 522


>SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 945

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 12/30 (40%), Positives = 21/30 (70%)
 Frame = +2

Query: 326 ILSIVRIRLSQSLLDIPAPLITSKST*LLQ 415
           ILSI+R  + + +  IPAP+++++   LLQ
Sbjct: 573 ILSILRKNIGKDISSIPAPVVSNEPCNLLQ 602


>SPAC57A7.06 |||U3 snoRNP protein Utp14 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 929

 Score = 27.1 bits (57), Expect = 2.2
 Identities = 9/38 (23%), Positives = 21/38 (55%)
 Frame = -2

Query: 381 GAGISSRLWERRIRTILRMNRISKRSMRLKHTLTNNRR 268
           G G+  R  + +++ I  ++   ++  +LKH + N +R
Sbjct: 829 GVGVKQRKTKPKVKKIAGLDPSKRKDSKLKHVIINEKR 866


>SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1010

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%)
 Frame = -3

Query: 188 QRANAIFLMHNMRSFFDFE-IMNFVH 114
           +RA +I   HN++S FD E I  FV+
Sbjct: 887 ERATSIMTKHNLKSSFDIEAIKEFVN 912


>SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1339

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 14/72 (19%), Positives = 34/72 (47%), Gaps = 6/72 (8%)
 Frame = +2

Query: 278 FVNVCFSLIDLLEIRFILSIVR------IRLSQSLLDIPAPLITSKST*LLQYLKIFFSC 439
           F N+   ++D L+   ++ +++      +   + +L +  P I  K   L +   + F C
Sbjct: 393 FANIYDRVLDFLDFEALIPLLQQFQVKLVFFLKDVLPVLKPKIRKKLLRLFETYNLIFPC 452

Query: 440 RVKYLFSLDFYI 475
              ++F+L+F +
Sbjct: 453 NQYWVFNLEFLL 464


>SPBC4B4.08 |ght2||hexose transporter Ght2 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 531

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -3

Query: 419 GTEVIMSIYWLLKAPEYLVDSGKDE 345
           G   ++ I +L ++P YL+  GKDE
Sbjct: 193 GIITMIGILFLPESPRYLIQVGKDE 217


>SPAC1687.17c |||Der1-like |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 168

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 6/18 (33%), Positives = 12/18 (66%)
 Frame = +2

Query: 566 FTVKLIFTSDIKGPYIPW 619
           + + ++   D+K PY+PW
Sbjct: 115 YRISILGLFDVKAPYVPW 132


>SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence
           orphan|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 776

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = -1

Query: 358 LGKTNPNNTENESYF*EIYETKTYINKQ*KAMQAPSNRN 242
           +GK N    +   YF  I E+  +IN Q   ++A + +N
Sbjct: 472 VGKENNCKNQYPQYFSNIDESNAFINNQCLELEALNRKN 510


>SPAC30C2.06c |dml1||mitochondrial genome maintenance protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 465

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = +1

Query: 316 NTIHSQYCSDSSFPESTRYSGAFNNQ*IDIITSVP*NLLQLQS 444
           N I S+Y   S  P+S +Y   FN   +D     P N  +L S
Sbjct: 123 NAIESEYELPSIRPKSVKYWSDFNRLFLDTEYLFPVNCSELNS 165


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,514,375
Number of Sequences: 5004
Number of extensions: 51556
Number of successful extensions: 109
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 105
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 109
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 271646730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).