SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC790.02 |pep3|vps18, vps18|ubiquitin-protein ligase E3 |Schiz...    29   0.61 
SPBC16H5.10c |prp43||ATP-dependent RNA helicase Prp43|Schizosacc...    27   2.5  
SPCC11E10.06c |||RNA polymerase II elongator complex subunit Elp...    26   3.2  
SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosac...    25   7.5  
SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch...    25   7.5  
SPCC364.05 |vps3||GTPase regulator Vps3 |Schizosaccharomyces pom...    25   9.9  

>SPCC790.02 |pep3|vps18, vps18|ubiquitin-protein ligase E3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 900

 Score = 28.7 bits (61), Expect = 0.61
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -2

Query: 470 LNSLPFYQNPLEILKTCRVTHMTFLSQKLFLRVALKVHK 354
           L S PF ++P+ ILK  +   MT ++ K  LR   K  +
Sbjct: 184 LYSFPFMESPMGILKNIQDDSMTIVTNKRILRFEPKTSR 222


>SPBC16H5.10c |prp43||ATP-dependent RNA helicase
           Prp43|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 735

 Score = 26.6 bits (56), Expect = 2.5
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = -2

Query: 500 AE*DSGPFVFLNSLPFYQNPLEILKTCR 417
           A+ + GP  F N  PF QN  +IL+T R
Sbjct: 46  AKAEEGPNNFFNDKPFSQNYFKILETRR 73


>SPCC11E10.06c |||RNA polymerase II elongator complex subunit Elp4
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 361

 Score = 26.2 bits (55), Expect = 3.2
 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 5/33 (15%)
 Frame = +1

Query: 322 VLCNTDVFKYCLCTLRATL-----KKSFWLKNV 405
           + C T V   C+C++ +TL     ++ FWL+N+
Sbjct: 236 IKCTTSVHLICMCSVPSTLFSRDCEQIFWLENL 268


>SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 853

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 15/27 (55%), Positives = 16/27 (59%)
 Frame = -2

Query: 113 ENLKLLKFTGASCAPVGTGRYYRPAYY 33
           EN   +K TGA  APV   RYY  AYY
Sbjct: 730 ENADFIK-TGAVVAPVTDWRYY-DAYY 754


>SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 845

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 10/15 (66%), Positives = 12/15 (80%), Gaps = 1/15 (6%)
 Frame = -2

Query: 482 PF-VFLNSLPFYQNP 441
           PF  F+N LPFYQ+P
Sbjct: 507 PFQFFINKLPFYQSP 521


>SPCC364.05 |vps3||GTPase regulator Vps3 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 910

 Score = 24.6 bits (51), Expect = 9.9
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 367 RATLKKSFWLKNVICVTRHVFSIS 438
           R+TL  SF+ K+V   + +VF+IS
Sbjct: 232 RSTLTFSFYPKHVFSTSHYVFAIS 255


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,189,876
Number of Sequences: 5004
Number of extensions: 42975
Number of successful extensions: 86
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 85
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 86
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 231978230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).