SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0235 - 10747649-10748118,10748226-10748314,10748477-107485...    30   1.1  
04_04_0964 - 29749624-29749649,29749742-29749945,29750036-297506...    29   3.4  
02_04_0648 - 24716249-24717841                                         29   3.4  
04_04_1357 + 32860677-32860781,32861484-32861588,32861678-328617...    28   4.5  
11_04_0102 - 13491071-13491415,13491427-13491720,13491799-13492323     28   6.0  
05_01_0003 + 29476-29847,30192-31519,31612-31722,31836-32112,322...    28   6.0  
04_03_0285 + 13899127-13899984,13900003-13900474,13901149-13901285     28   6.0  
02_02_0475 - 10746593-10748104                                         27   7.9  

>05_03_0235 -
           10747649-10748118,10748226-10748314,10748477-10748574,
           10748934-10749046,10749107-10749200,10749557-10749589,
           10749734-10749851,10750110-10750210,10751036-10751233,
           10751337-10751471,10751752-10751830,10753650-10753738,
           10753835-10753987,10754100-10754285
          Length = 651

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 3/53 (5%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAP---VLVHHHETRQYIMETSLN 287
           HD  H HG+    +H      HH     H  P   V  HHH+ +Q+  E   N
Sbjct: 540 HDHRHRHGHSHGDHHHHYHGGHHQRRRHHHPPAWDVEGHHHDRQQHSHEAGRN 592


>04_04_0964 -
           29749624-29749649,29749742-29749945,29750036-29750634,
           29750742-29750826,29750914-29751562,29751568-29751643,
           29753891-29753957,29754097-29754998,29756579-29756790
          Length = 939

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = -3

Query: 457 LGGVFHNTDRSISFMQRVVALHDITVASL 371
           +GGVFHN D  +SF    +   D TVAS+
Sbjct: 737 MGGVFHNEDGVLSFFIGSLGNVDQTVASI 765


>02_04_0648 - 24716249-24717841
          Length = 530

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 2/30 (6%)
 Frame = -1

Query: 111 RDGVYGHDCSRDAL--GYSRLSVQVLAREL 28
           +DG YGHD  R +L  GYSR  +   AR+L
Sbjct: 142 KDGFYGHDFIRTSLLDGYSRYGMMGDARKL 171


>04_04_1357 +
           32860677-32860781,32861484-32861588,32861678-32861728,
           32861829-32861949,32862495-32862616,32863032-32863133,
           32863226-32863300,32863391-32863470,32863601-32863751,
           32863850-32864080,32864221-32864517,32864638-32864751,
           32864857-32865030
          Length = 575

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 13/40 (32%), Positives = 24/40 (60%)
 Frame = -2

Query: 314 IWDEHHNLHIEAGLHDVLARFMVMHEHGCSVYSRSSMMRC 195
           +W++  +  +E GLHD+L   + +++H    +SR  M RC
Sbjct: 489 VWNQTFDFVVEDGLHDML--MLEVYDH--DTFSRDYMGRC 524


>11_04_0102 - 13491071-13491415,13491427-13491720,13491799-13492323
          Length = 387

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +3

Query: 384 VMS*RATTLCMKLMDLSVLWNTPPSKHNGFNAVVQAHCSDKAAEPVQQYYHH 539
           ++S + ++L ++L DL+ L +   +KH+G   +    CSD+  E ++ Y  H
Sbjct: 272 LLSLQFSSLMVELHDLNAL-SMAVNKHHGIRLLGSYICSDEQEEGLKHYNGH 322


>05_01_0003 +
           29476-29847,30192-31519,31612-31722,31836-32112,
           32233-33714
          Length = 1189

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = -2

Query: 263 LARFMVMHEHGCSVYSRSSMMRCYWY 186
           L R +++H H C  YSR S M CY++
Sbjct: 889 LERLLLVHGHWC--YSRISAMICYFF 912


>04_03_0285 + 13899127-13899984,13900003-13900474,13901149-13901285
          Length = 488

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = +3

Query: 111 AVSSQSIIRHDVTHGHGNEGQSYHVVPVAAHHG 209
           AV +  ++RH V H  G +G+  H   V  H G
Sbjct: 149 AVYNIGLLRHSVAHPGGGDGEHGHYYIVTLHPG 181


>02_02_0475 - 10746593-10748104
          Length = 503

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +3

Query: 150 HGHGNEGQSYHVVPVAAHHGAPTIHA 227
           HG G+E ++Y V P+ A  GA  + +
Sbjct: 64  HGRGDEDEAYFVAPMGAGDGARQVRS 89


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,281,785
Number of Sequences: 37544
Number of extensions: 318373
Number of successful extensions: 815
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 792
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 815
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1305140760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).