SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0329 - 21037980-21038378,21038517-21038737,21038827-210389...    32   0.28 
11_03_0128 - 10437407-10438049,10438097-10438272                       29   1.5  
10_08_0520 - 18495118-18498237                                         29   2.0  
06_01_0816 - 6171189-6171255,6171277-6171441,6172037-6172618,617...    29   2.0  
01_01_1127 + 8930593-8932681,8932812-8933401                           29   2.0  
09_04_0500 - 18120287-18122233                                         29   2.6  
06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776     29   2.6  
08_02_0157 - 13385589-13385675,13386187-13386357,13386572-133867...    28   4.6  
05_06_0224 + 26546066-26546830                                         28   4.6  
04_03_0633 + 18208116-18208732,18209916-18210129                       28   4.6  
07_01_0361 - 2655442-2655706,2656339-2656466,2658428-2658438,265...    27   6.0  
01_06_1822 - 40132919-40133208,40134313-40134398,40135067-401355...    27   6.0  
08_02_1080 - 24197514-24199415                                         27   8.0  

>01_05_0329 -
           21037980-21038378,21038517-21038737,21038827-21038905,
           21039002-21039071,21039144-21039255,21039359-21039398,
           21039482-21039676,21039925-21040044,21040684-21041106,
           21042386-21042928
          Length = 733

 Score = 31.9 bits (69), Expect = 0.28
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = -1

Query: 395 IRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERR 285
           ++T T +   +S RPR  D+E  ++  L PYSSE++R
Sbjct: 442 MQTITDSGEDNSRRPRSGDSEIPNSSKLEPYSSEQQR 478


>11_03_0128 - 10437407-10438049,10438097-10438272
          Length = 272

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = -3

Query: 186 SSSRGTEYSTTCRTARRAYSKARMACDTGGKAS 88
           S S  +  STTCRT  RA   +   C TG + S
Sbjct: 132 SRSTASTSSTTCRTCCRATPNSTSPCKTGSRCS 164


>10_08_0520 - 18495118-18498237
          Length = 1039

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +1

Query: 313 RARVELRSASWHRGLQELWRLFAVVVRMLGNVGD 414
           RAR+ L  A    G + +W   A+V R LGNV +
Sbjct: 751 RARILLSKARERGGTERVWMKSAIVERELGNVDE 784


>06_01_0816 -
           6171189-6171255,6171277-6171441,6172037-6172618,
           6173451-6173761
          Length = 374

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 76  GLVVLGPEDWSEISVLNWSQKIS 8
           G VV GP  W EI +  WSQ+ S
Sbjct: 42  GRVVAGPYCWQEIDIQEWSQQQS 64


>01_01_1127 + 8930593-8932681,8932812-8933401
          Length = 892

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +1

Query: 313 RARVELRSASWHRGLQELWRLFAVVVRMLGNVGD 414
           RAR+ L  A    G + +W   A+V R LGNV +
Sbjct: 656 RARILLSKARERGGTERVWMKSAIVERELGNVDE 689


>09_04_0500 - 18120287-18122233
          Length = 648

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +1

Query: 268 AVSVPERRSSDEYGRRARVELRSASWHR 351
           AV+V +R  S EY   +R E RS SW R
Sbjct: 2   AVAVLDRSFSSEYPASSRTEGRSCSWKR 29


>06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776
          Length = 833

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 16/36 (44%), Positives = 17/36 (47%)
 Frame = +2

Query: 218 SVSRHTQMRTAMAFEXTLSPFPSDAPLTSMDVERAL 325
           SVS   + R A A     S FPS  P T  DV R L
Sbjct: 139 SVSSRRRARRAAAVTRRSSAFPSSTPPTQEDVRRGL 174


>08_02_0157 -
           13385589-13385675,13386187-13386357,13386572-13386792,
           13390090-13390240,13390682-13390726,13391121-13391330
          Length = 294

 Score = 27.9 bits (59), Expect = 4.6
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 237 WVWRLTDHLTTASNGSDSSSRGT 169
           WV  L + +TTASN  D+ SR T
Sbjct: 163 WVELLVNEMTTASNMDDAKSRAT 185


>05_06_0224 + 26546066-26546830
          Length = 254

 Score = 27.9 bits (59), Expect = 4.6
 Identities = 12/46 (26%), Positives = 22/46 (47%)
 Frame = +1

Query: 286 RRSSDEYGRRARVELRSASWHRGLQELWRLFAVVVRMLGNVGDWPL 423
           RR  D YG     + +  + H G+++   + A++ R LG    W +
Sbjct: 23  RRVVDMYGHHVGFKAKVVALHGGIRQARAVHAILSRQLGGEKKWEI 68


>04_03_0633 + 18208116-18208732,18209916-18210129
          Length = 276

 Score = 27.9 bits (59), Expect = 4.6
 Identities = 22/73 (30%), Positives = 29/73 (39%)
 Frame = -3

Query: 288 SLGNGDSVXSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMAC 109
           SLG       NA+A+L+W+ R          G D+  R      T   A R  S+AR   
Sbjct: 25  SLGVPPPPARNAVALLMWLGR-----RGGGAGVDAVDRARRLVRTRHDAARLASEARAVL 79

Query: 108 DTGGKASWLLKAW 70
             G  A  L + W
Sbjct: 80  HGGAAALDLARRW 92


>07_01_0361 -
           2655442-2655706,2656339-2656466,2658428-2658438,
           2659586-2659704,2659746-2659906,2660115-2660132
          Length = 233

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +1

Query: 328 LRSASWHRGLQELWRLFAV-VVRMLGNVGDWPLNIVTR 438
           LRS  W + +  LW  F+V +V  L +V  W L + +R
Sbjct: 58  LRSFEWLKQIVALWSQFSVNLVITLEDVAPWLLTVASR 95


>01_06_1822 -
           40132919-40133208,40134313-40134398,40135067-40135566,
           40135708-40135905
          Length = 357

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 3/47 (6%)
 Frame = +2

Query: 257 FEXTL--SPFPSDAPLTSMDV-ERALSFAPRRGTAVFKSSGGCSLSW 388
           FE TL   PF  +    + DV  +A+  A     A F S GGC++SW
Sbjct: 56  FEFTLHTDPFQVNYRAVAADVISKAVIVAVIGAWARFMSKGGCAVSW 102


>08_02_1080 - 24197514-24199415
          Length = 633

 Score = 27.1 bits (57), Expect = 8.0
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +1

Query: 268 AVSVPERRSSDEYGRRARVELRSASWHR 351
           AV+VP+   ++ Y  + ++E RS SW R
Sbjct: 2   AVAVPDHTFNNGYSSKNQIEGRSLSWKR 29


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,607,574
Number of Sequences: 37544
Number of extensions: 226927
Number of successful extensions: 753
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 753
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 999806640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).