SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_1100 + 8716853-8716860,8717739-8717844,8717931-8718015,871...    29   0.99 
01_01_1024 + 8083372-8083758,8083970-8084149,8084261-8084590,808...    29   1.3  
04_04_1271 - 32282865-32283167,32283429-32283561,32283683-322839...    28   2.3  
04_04_1098 + 30876785-30876835,30876846-30877171,30877396-308774...    28   2.3  
07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753...    27   4.0  
02_05_0936 - 32875479-32875573,32875794-32876028,32877752-328778...    27   4.0  
12_02_0423 + 18944555-18945226,18945309-18945545                       27   5.3  
07_01_0431 + 3283252-3283274,3283684-3283819,3285839-3286682,328...    27   5.3  
04_04_0514 - 25816808-25817318,25817865-25817994,25818083-25818215     27   5.3  
10_08_0850 + 21050164-21050189,21050874-21050979,21051186-210512...    27   7.0  

>01_01_1100 +
           8716853-8716860,8717739-8717844,8717931-8718015,
           8718632-8718715,8718969-8719073,8719621-8719898
          Length = 221

 Score = 29.5 bits (63), Expect = 0.99
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%)
 Frame = +2

Query: 185 KTKFPSAQK---AQGAPQSSGKSHDEPRRHQNQRQSEKSARG 301
           +++F S  K   +QG+ QS G+   EP    NQ++ ++S+ G
Sbjct: 136 RSRFTSGSKNRSSQGSAQSLGQQSAEPAHKHNQKRKDESSLG 177


>01_01_1024 +
           8083372-8083758,8083970-8084149,8084261-8084590,
           8084679-8084792,8084942-8085682
          Length = 583

 Score = 29.1 bits (62), Expect = 1.3
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 218 GAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           GA  ++GKSHD+  +  N R++  S R R
Sbjct: 266 GAAGAAGKSHDQQAQDANMRKARVSVRAR 294


>04_04_1271 -
           32282865-32283167,32283429-32283561,32283683-32283908,
           32284058-32284274,32284398-32284558,32285309-32285449,
           32285621-32286944
          Length = 834

 Score = 28.3 bits (60), Expect = 2.3
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = -3

Query: 204 AEGNLVFRC*SSNICSILLRLLSGRRTIIFPSVVQQ 97
           A+GNL  +C   +   +LL ++SG+R    P+ +++
Sbjct: 699 AQGNLTLKCDVYSFGVVLLEIISGKRNRTLPTFLRE 734


>04_04_1098 +
           30876785-30876835,30876846-30877171,30877396-30877418,
           30877687-30879392
          Length = 701

 Score = 28.3 bits (60), Expect = 2.3
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +2

Query: 203 AQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           AQ+ +   ++SGK+ D+ +RH     S+  AR R
Sbjct: 540 AQRGKEKEENSGKNVDKRKRHDTDSDSDSHARER 573


>07_03_0481 -
           18572206-18574314,18574591-18575185,18575304-18575371,
           18577344-18577458,18578179-18578333,18578673-18580621,
           18580691-18581372,18581550-18581621,18582558-18583199,
           18583301-18583402,18585011-18585100
          Length = 2192

 Score = 27.5 bits (58), Expect = 4.0
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 164 MFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQ 268
           M +  HL T+F   + +Q   +  G SH +PR HQ
Sbjct: 557 MVKYAHLVTQFKKFE-SQALDKDKGGSHAKPREHQ 590


>02_05_0936 -
           32875479-32875573,32875794-32876028,32877752-32877848,
           32878863-32878927,32879506-32879571,32879735-32879842,
           32880169-32880303,32880582-32880647,32881172-32881222,
           32881312-32881386,32881834-32881896,32882694-32882783,
           32882903-32883100,32883189-32883315,32883482-32884100,
           32884228-32884265,32884651-32884718,32885056-32885100,
           32885243-32885302,32885510-32885593,32885677-32885868,
           32887361-32887663
          Length = 959

 Score = 27.5 bits (58), Expect = 4.0
 Identities = 21/62 (33%), Positives = 31/62 (50%)
 Frame = +3

Query: 132 SRIINAVRLNRCLNFSI*KPSFPRLKKRKELLSHLGNLMTNQDGTKISGRARNRQEDDSS 311
           SR++NAV ++   N  I   S P+L ++KELLS L    +   G     R R   E   +
Sbjct: 679 SRLVNAVVIDANKN-QIKSTSVPQLPQQKELLSALRPYHSRLVGESFLARKRPVYECTDA 737

Query: 312 KV 317
           +V
Sbjct: 738 QV 739


>12_02_0423 + 18944555-18945226,18945309-18945545
          Length = 302

 Score = 27.1 bits (57), Expect = 5.3
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 200 SAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           +A+  +G   +S   HD+ R H +  Q+ +SA  R
Sbjct: 135 AAEAKKGGAAASHDDHDDGRHHHHHNQAVQSAAAR 169


>07_01_0431 +
           3283252-3283274,3283684-3283819,3285839-3286682,
           3286785-3286856,3286906-3286937,3287020-3287433
          Length = 506

 Score = 27.1 bits (57), Expect = 5.3
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 80  HFGVKRCWTTDGK 118
           H  +KRCWT+DG+
Sbjct: 99  HHHIKRCWTSDGQ 111


>04_04_0514 - 25816808-25817318,25817865-25817994,25818083-25818215
          Length = 257

 Score = 27.1 bits (57), Expect = 5.3
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 8/79 (10%)
 Frame = +2

Query: 119 IIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQS----- 283
           I   LP    ++I+ ++   HLK +  +  +      S GK H +P+  +    +     
Sbjct: 92  IAARLPGRTDNEIKNVWHT-HLKKRLDAPAQGGHVAASGGKKHKKPKSAKKPAAAAAAPP 150

Query: 284 ---EKSARGRLVESSMAVS 331
              E+SA   + ESSMA S
Sbjct: 151 ASPERSASSSVTESSMASS 169


>10_08_0850 + 21050164-21050189,21050874-21050979,21051186-21051257,
            21051775-21051828,21052077-21052184,21052653-21052802,
            21052914-21053258,21053361-21054801,21054844-21055675,
            21057060-21057325,21057530-21059603,21060172-21060442,
            21060556-21060990
          Length = 2059

 Score = 26.6 bits (56), Expect = 7.0
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 8/78 (10%)
 Frame = +2

Query: 122  IVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAP------QSSGKSHDEPRRHQNQRQS 283
            + LL +    +  ++FE+  L  +  SA  A  AP      Q S ++HDE   H N+  S
Sbjct: 1200 LALLRETLGDRFSRIFEIS-LAVEASSAVAASFAPPKAHRSQQSSETHDESGNHANEVPS 1258

Query: 284  --EKSARGRLVESSMAVS 331
               K    + V+ S AVS
Sbjct: 1259 NPSKCFNVKAVKVSAAVS 1276


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,037,606
Number of Sequences: 37544
Number of extensions: 190435
Number of successful extensions: 605
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 600
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 605
length of database: 14,793,348
effective HSP length: 74
effective length of database: 12,015,092
effective search space used: 660830060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).