BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a10f (605 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51625| Best HMM Match : LRR_1 (HMM E-Value=2.7e-10) 40 0.001 SB_2154| Best HMM Match : LRR_1 (HMM E-Value=4.9e-06) 39 0.004 SB_53214| Best HMM Match : LRR_1 (HMM E-Value=7.4e-06) 38 0.006 SB_38674| Best HMM Match : TIR (HMM E-Value=2.5e-31) 36 0.034 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) 31 0.72 SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) 28 5.1 SB_25208| Best HMM Match : PAN (HMM E-Value=0.019) 28 5.1 SB_34117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_19634| Best HMM Match : LRR_1 (HMM E-Value=2.6e-17) 27 8.9 >SB_51625| Best HMM Match : LRR_1 (HMM E-Value=2.7e-10) Length = 212 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = +3 Query: 357 CPKPCVCHTE---GD-SSNFVVDCSGYGLTEFPTPLDVRTTILNLQNNKLT 497 CP C C E G+ S+ +V+C+G L FP PL RT+ L L +N+L+ Sbjct: 74 CPAKCECSREKIAGELSTGILVNCTGRRLRNFPLPLPPRTSTLLLNDNRLS 124 >SB_2154| Best HMM Match : LRR_1 (HMM E-Value=4.9e-06) Length = 150 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = +3 Query: 333 ATQSGDSTCPKP----CVCHTEGDSSNFVVDCSGYGLTEFPTPLDVRTTILNLQNNKLTG 500 A + CP+P C C G +N V C GL EFP + + TT L+L NKL Sbjct: 5 AATGAHAPCPRPAVGTCTCVQTGSYTN--VKC--LGLDEFPLDVPINTTSLDLSENKLVS 60 Query: 501 IP 506 P Sbjct: 61 FP 62 >SB_53214| Best HMM Match : LRR_1 (HMM E-Value=7.4e-06) Length = 298 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +3 Query: 357 CPKPCVCHTEGDSSNFVVDCSGYGLTEFPTPLDVRTTILNLQNNKLTGIP 506 CP+ C C+T S + +C G LT FP +D T L L N+L +P Sbjct: 5 CPQKCSCYTR---SWLITNCRGKYLTSFPDQVDNTTVELILTYNRLKALP 51 >SB_38674| Best HMM Match : TIR (HMM E-Value=2.5e-31) Length = 870 Score = 35.5 bits (78), Expect = 0.034 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +3 Query: 357 CPKPCVCHTEGDSSNFVVDCSGYGLTEFPTPLDVRTTILNLQNNKLTGIP 506 CP+ C C +VDCS GL P + +NL+ N + +P Sbjct: 484 CPRECTCAVREIDQTVLVDCSERGLHRLPFKMPAGELEVNLRGNAIRELP 533 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 31.9 bits (69), Expect = 0.41 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +3 Query: 291 LLEDVQLTANAEGTATQSGDSTCPKPCVCHTEGDSS---NFVVDCSGYGLTEFPTPLDVR 461 LL +Q + S TCP C C+ E ++ D S GL P ++ Sbjct: 10 LLSTLQCVRLGQANVISSVPITCPAYCSCYGEHRVDIYCGYLADDSFSGLRHVPRNFPMQ 69 Query: 462 TTILNLQNNKLTGI 503 ++L+L NN ++ I Sbjct: 70 VSLLSLYNNLISTI 83 >SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) Length = 1655 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 369 CVCHTEGDSSNFVVDCSGYGLTEFPTPLDVRTTILNLQNNKLTGIPKD 512 CV T G S + + +T FP+ L +TI++L N L +P D Sbjct: 799 CVPITHGSKSLVLTASHHHTITTFPSSLPQTSTIIDLSENLLKVLPPD 846 >SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) Length = 1206 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 357 CPKPCVC-HTEGDSSNFVVDCSGYGLTEFPTPLDVRTTILNLQNNKLTGI 503 CP C C +T G ++ G LT P + + T L +N++T + Sbjct: 960 CPSSCSCVYTSGSGPRRIL-VKGQELTAIPKTMPLDTFALMFSSNRITNV 1008 >SB_25208| Best HMM Match : PAN (HMM E-Value=0.019) Length = 245 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 469 IVVRTSKGVGNSVSPYPEQSTTKLLESP 386 ++++T G+ SVS Y E T KLLE P Sbjct: 11 LLIQTITGISASVSQYFETHTDKLLEVP 38 >SB_34117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 379 WHTHGFGHVESPDCVAVPSALAVN 308 W THG GH+ S V L VN Sbjct: 93 WRTHGTGHIRSTTVTQVLKILMVN 116 >SB_19634| Best HMM Match : LRR_1 (HMM E-Value=2.6e-17) Length = 267 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 465 TILNLQNNKLTGIPKDVASXXXXXXXXXXXXSIMGL--DLGSVSELPGL 605 T+L+L +N LT IP+D+ I GL +G++S L L Sbjct: 130 TVLDLHDNLLTSIPEDIIILRDLERLDLTNNDISGLPYKIGNMSNLKSL 178 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,413,205 Number of Sequences: 59808 Number of extensions: 291074 Number of successful extensions: 735 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -