BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C02 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38737| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 3e-16 SB_53704| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-18) 72 5e-13 SB_38739| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_38740| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_23535| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_59476| Best HMM Match : HLH (HMM E-Value=1.2e-15) 52 5e-07 SB_47705| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_57929| Best HMM Match : K-box (HMM E-Value=4.3) 31 1.1 SB_55895| Best HMM Match : ig (HMM E-Value=2.2e-05) 29 2.5 SB_39813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_20449| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_25294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_23341| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.065) 28 5.7 SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_38737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 82.2 bits (194), Expect = 3e-16 Identities = 44/115 (38%), Positives = 64/115 (55%) Frame = +1 Query: 139 RKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTVXXXXXXXXX 318 +K P +E+ RRARIN L+EL L++ A++ + K+EKADILE+TV Sbjct: 22 KKSKKPQMEKLRRARINDSLNELKSLVLEAMKKDASRYSKMEKADILEMTVKYLRSAPEK 81 Query: 319 XXXXXNPTVDVDRFRAGFTHAAXEVSRCLASIPGVDVRLGTQLMTHLGHRLNEMQ 483 +PT + ++RAG+ A EV+R L S V +L TQL++HL R Q Sbjct: 82 QSKISDPT-SLAKYRAGYNECAAEVTRFLLSSENVSDQLRTQLLSHLASRCYTQQ 135 >SB_53704| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-18) Length = 722 Score = 71.7 bits (168), Expect = 5e-13 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 3/105 (2%) Frame = +1 Query: 154 PMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTVXXXXXXXXXXXXXX 333 PM+E+ RRARIN+ L+EL L++ A++ + KLEKADILE+TV Sbjct: 470 PMMEKRRRARINQSLNELKILILEAMKKDTSCYSKLEKADILEMTVKYLRAMKTTQQLTG 529 Query: 334 NPTVD---VDRFRAGFTHAAXEVSRCLASIPGVDVRLGTQLMTHL 459 D V ++RAGF A EV+R + VD+++ T++++HL Sbjct: 530 IVPSDPSSVAQYRAGFNECALEVTRYFMANDNVDLQMKTRILSHL 574 >SB_38739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 68.9 bits (161), Expect = 3e-12 Identities = 42/107 (39%), Positives = 53/107 (49%) Frame = +1 Query: 139 RKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTVXXXXXXXXX 318 RK PM+E+ RRARIN L+EL L++ L + K+EKADILE+TV Sbjct: 20 RKAKKPMMEKLRRARINDSLNELKVLVLELLNKDASRYSKMEKADILEMTVGYLRAAQRI 79 Query: 319 XXXXXNPTVDVDRFRAGFTHAAXEVSRCLASIPGVDVRLGTQLMTHL 459 T D FRAGF A EVS L+ L L++HL Sbjct: 80 EKRTQGSTPPSD-FRAGFNACAVEVSNRLSPADANTDNLRETLLSHL 125 >SB_38740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = +1 Query: 139 RKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTV 291 R++M P+ ER RR RIN L EL L++SAL + ++EKADILE+TV Sbjct: 23 RRIMKPITERLRRERINSSLKELKFLVLSALGQDVSRYSRMEKADILEMTV 73 >SB_23535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = +1 Query: 139 RKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTV 291 RK P++E+ RR RINR L+EL L++ A + KLEKADILE+TV Sbjct: 21 RKWSKPVMEKRRRERINRSLEELKRLVLEAQHRDCSRYTKLEKADILEMTV 71 >SB_59476| Best HMM Match : HLH (HMM E-Value=1.2e-15) Length = 272 Score = 51.6 bits (118), Expect = 5e-07 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +1 Query: 139 RKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTV 291 RK ++E+ RR RINRCL EL L+ +AL+ EG + KLEKA+IL LTV Sbjct: 12 RKRRRGLIEKKRRDRINRCLVELRRLVPTALEKEGSS--KLEKAEILHLTV 60 >SB_47705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 48.8 bits (111), Expect = 4e-06 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 5/55 (9%) Frame = +1 Query: 142 KVMXPMLERXRRARINRCLDELXELMVSAL-----QSEGXNVXKLEKADILELTV 291 K P+LER RRARIN L+EL L++S+L Q+E N K+EKA+ILELTV Sbjct: 20 KSSKPLLERQRRARINHSLNELKTLVLSSLYQNCPQAE-QNCEKMEKAEILELTV 73 >SB_57929| Best HMM Match : K-box (HMM E-Value=4.3) Length = 213 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +1 Query: 97 AEDGPQPVSRTYQYRKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLE 264 AED P PVS+ Q K + LE +R N +E ELM L+ +G K++ Sbjct: 120 AEDQPSPVSQQKQKIKYLSKPLEGVKRLLSNLFTEE--ELMRCTLKGKGRTSNKMQ 173 >SB_55895| Best HMM Match : ig (HMM E-Value=2.2e-05) Length = 420 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = -2 Query: 571 GSRNQTMKKQSREQGWEGLLVEFQCQRLLAAFRSVCARGGSLVECPTSRPH 419 G+ N T+ KQ Q W G +V F R C ECP H Sbjct: 320 GAINITITKQGSSQAWGGGVVTFSPVSAADQARYTCTAREGASECPAVTKH 370 >SB_39813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +1 Query: 97 AEDGPQPVSRTYQYRKVMXPMLERXRRARINRCLDELXELMVSALQSEG 243 AED P PVS+ Q K + LE +R N +E ELM L+ +G Sbjct: 67 AEDQPSPVSQQKQKIKYLSKPLEGVKRLLSNLFTEE--ELMRCTLKGKG 113 >SB_20449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 97 AEDGPQPVSRTYQYRKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLE 264 AED P PVS+ Q K + LE +R + +E ELM L+ +G K++ Sbjct: 67 AEDQPSPVSQQKQKIKYLSKPLEGVKRLLSDLFTEE--ELMRCTLKGKGRTSNKMQ 120 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 97 AEDGPQPVSRTYQYRKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLE 264 AED P PVS+ Q K + LE +R + +E ELM L+ +G K++ Sbjct: 212 AEDQPSPVSQQKQKIKYLSKPLEGVKRLLSDLFTEE--ELMRCTLKGKGRTSNKMQ 265 >SB_25294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 97 AEDGPQPVSRTYQYRKVMXPMLERXRRARINRCLDELXELMVSALQSEGXNVXKLE 264 AED P PVS+ Q K + LE +R + +E ELM L+ +G K++ Sbjct: 7 AEDQPSPVSQQKQKIKYLSKPLEGVKRLLSDLFTEE--ELMRCTLKGKGRTSNKMQ 60 >SB_23341| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.065) Length = 263 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 11 RASTLFANVRSYSRHTYXQHVIRDRVFRSRKTVRSQSRALI 133 +A TL VRS S TY H I ++R +T+ SR+ + Sbjct: 197 KADTLGDFVRSLSEFTY-SHAIVSELYRQYRTINQTSRSAV 236 >SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1270 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 38 RSYSRHTYXQHVIRDRVFRSRKTVRSQSRALIN 136 R + RH ++ +RDR SRK +R + +AL N Sbjct: 921 RLHDRHEASRNRLRDRHEASRKRLRDRHKALCN 953 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,617,558 Number of Sequences: 59808 Number of extensions: 320788 Number of successful extensions: 774 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -