SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_57207| Best HMM Match : Transposase_22 (HMM E-Value=0.17)           35   0.021
SB_53000| Best HMM Match : Transposase_22 (HMM E-Value=0.026)          35   0.021
SB_31647| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.047
SB_45202| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.33 
SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12)                 30   0.77 
SB_57452| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.77 
SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.77 
SB_936| Best HMM Match : DUF1127 (HMM E-Value=3.2)                     30   0.77 
SB_48988| Best HMM Match : DUF1127 (HMM E-Value=1.5)                   29   1.0  
SB_1075| Best HMM Match : rve (HMM E-Value=0.0089)                     29   1.0  
SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_39791| Best HMM Match : RVT_1 (HMM E-Value=0.083)                   28   3.1  
SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   3.1  
SB_36059| Best HMM Match : TolA (HMM E-Value=0.1)                      27   4.1  
SB_27138| Best HMM Match : Ebp2 (HMM E-Value=1.8)                      27   4.1  
SB_49533| Best HMM Match : Ldh_2 (HMM E-Value=0)                       27   5.4  
SB_22154| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_59010| Best HMM Match : rve (HMM E-Value=0.0052)                    27   7.2  
SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047)                 27   7.2  
SB_9870| Best HMM Match : GspM (HMM E-Value=1.9)                       27   7.2  
SB_4563| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   7.2  
SB_49753| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-30)          26   9.5  
SB_2704| Best HMM Match : TP2 (HMM E-Value=6.9)                        26   9.5  
SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9)             26   9.5  
SB_56575| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.5  
SB_53151| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.5  
SB_35426| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.5  
SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14)                   26   9.5  
SB_8182| Best HMM Match : ATP-synt_E (HMM E-Value=1.8)                 26   9.5  
SB_6427| Best HMM Match : RBM1CTR (HMM E-Value=0.42)                   26   9.5  

>SB_57207| Best HMM Match : Transposase_22 (HMM E-Value=0.17)
          Length = 262

 Score = 35.1 bits (77), Expect = 0.021
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = +2

Query: 8   KGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFELQHLK 187
           K  ++ ++E LTK R D      S   + + WT DG I V L  +K    E +  L+ LK
Sbjct: 193 KKDKLRVNEDLTKGRLDAIKAINSKLDIYKLWTIDGTIHVRLNKDKDKAKEIIHSLRQLK 252


>SB_53000| Best HMM Match : Transposase_22 (HMM E-Value=0.026)
          Length = 301

 Score = 35.1 bits (77), Expect = 0.021
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = +2

Query: 8   KGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFELQHLK 187
           K  ++ ++E LTK R D      S   + + WT DG I V L  +K    E +  L+ LK
Sbjct: 232 KKEKLRVNEDLTKGRLDAIKAINSKLDIYKLWTIDGTIHVRLNKDKDKAKEIIHSLRQLK 291


>SB_31647| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 381

 Score = 33.9 bits (74), Expect = 0.047
 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 3/80 (3%)
 Frame = +2

Query: 5   LKGSRVIISEFLTKSRHDVF---LEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFEL 175
           L  + + ISE LT +   +F   L  +  F  K  WT  GK  VL+  ++ S   Q+  L
Sbjct: 297 LADNSIYISESLTANNKAIFKGALSFKKEFRFKFIWTVHGK--VLIRKDEHSPAIQIKSL 354

Query: 176 QHLKTKFPSAQKAQGAPQSS 235
           QHL       +  Q APQ S
Sbjct: 355 QHL----ADLRSEQAAPQQS 370


>SB_45202| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 380

 Score = 31.1 bits (67), Expect = 0.33
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 5/84 (5%)
 Frame = +2

Query: 14  SRVIISEFLTKSRHDVF---LEARSHFGVKRCWTTDGKIIVLL-PDNKRSKIEQMFELQH 181
           +++ ISE L+    ++F   L AR     K  WT +GK+ +    D++   I +  +L H
Sbjct: 123 NKIYISESLSPGNRELFKAALSARHDLKFKYIWTQNGKVFLRKNNDSQAVLISKSQDLLH 182

Query: 182 LKTKFP-SAQKAQGAPQSSGKSHD 250
           LK +    +Q+ + A  +  K+ D
Sbjct: 183 LKQREDHHSQEVESANLTGTKAFD 206


>SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12)
          Length = 792

 Score = 29.9 bits (64), Expect = 0.77
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 4/64 (6%)
 Frame = +2

Query: 14  SRVIISEFLTKSRHDVF---LEARSHFGVKRCWTTDGKIIVLL-PDNKRSKIEQMFELQH 181
           +++ ISE L+    ++F   L AR     K  WT +GK+ +    D++   I +  +L H
Sbjct: 123 NKIYISESLSPGNRELFKAALSARHDLKFKYIWTQNGKVFLRKNNDSQAVLISKSQDLLH 182

Query: 182 LKTK 193
           LK +
Sbjct: 183 LKQR 186


>SB_57452| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 29.9 bits (64), Expect = 0.77
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 4/64 (6%)
 Frame = +2

Query: 14  SRVIISEFLTKSRHDVF---LEARSHFGVKRCWTTDGKIIVLL-PDNKRSKIEQMFELQH 181
           +++ ISE L+    ++F   L AR     K  WT +GK+ +    D++   I +  +L H
Sbjct: 27  NKIYISESLSPGNRELFKAELSARHDLKFKYIWTQNGKVFLRKNNDSQAVLISKSQDLLH 86

Query: 182 LKTK 193
           LK +
Sbjct: 87  LKQR 90


>SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 957

 Score = 29.9 bits (64), Expect = 0.77
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           +M E Q   +  P  Q AQG  Q  GK H EP R
Sbjct: 749 EMEEHQGSTSAQPDEQLAQGLAQEPGKQHQEPAR 782


>SB_936| Best HMM Match : DUF1127 (HMM E-Value=3.2)
          Length = 280

 Score = 29.9 bits (64), Expect = 0.77
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 4/64 (6%)
 Frame = +2

Query: 14  SRVIISEFLTKSRHDVF---LEARSHFGVKRCWTTDGKIIVLL-PDNKRSKIEQMFELQH 181
           +++ ISE L+    ++F   L AR     K  WT +GK+ +    D++   I +  +L H
Sbjct: 201 NKIYISESLSPGNRELFKAALSARHDLKFKYIWTQNGKVFLRKNNDSQAVLISKSQDLLH 260

Query: 182 LKTK 193
           LK +
Sbjct: 261 LKQR 264


>SB_48988| Best HMM Match : DUF1127 (HMM E-Value=1.5)
          Length = 270

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%)
 Frame = +2

Query: 14  SRVIISEFLTKSRHDVF---LEARSHFGVKRCWTTDGKIIVLL-PDNKRSKIEQMFELQH 181
           +++ ISE L+    ++F   L AR     K  WT +GK+ +    D +   I +  +L H
Sbjct: 191 NKIYISESLSPGNRELFKAALSARHDLKFKYIWTQNGKVFLRKNNDGQAVLISKSQDLLH 250

Query: 182 LKTK 193
           LK +
Sbjct: 251 LKQR 254


>SB_1075| Best HMM Match : rve (HMM E-Value=0.0089)
          Length = 1617

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +2

Query: 161  QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
            +M E Q   +  P  Q AQ   Q  GK H EP RH
Sbjct: 1113 EMEEPQGSTSAQPDEQLAQELAQEPGKRHQEPARH 1147


>SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1387

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 14/42 (33%), Positives = 26/42 (61%)
 Frame = +2

Query: 197  PSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRLVESSM 322
            P+  +A+     SGKSH++     +++ SE S++G+LV S +
Sbjct: 1255 PACVRAECCGNKSGKSHED-----SKKASETSSKGKLVSSKL 1291


>SB_39791| Best HMM Match : RVT_1 (HMM E-Value=0.083)
          Length = 497

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 4/64 (6%)
 Frame = +2

Query: 14  SRVIISEFLTKSRHDVF---LEARSHFGVKRCWTTDGKIIVLL-PDNKRSKIEQMFELQH 181
           +++ ISE L+    ++F   L AR     K  WT +GK+ +    D++   I +  +  H
Sbjct: 150 NKIYISESLSPGNRELFKAALSARHDLKFKYIWTQNGKVFLRKNKDSQAVLISKSQDSLH 209

Query: 182 LKTK 193
           LK +
Sbjct: 210 LKQR 213


>SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1109

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 15/34 (44%), Positives = 16/34 (47%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           QM E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 739 QMGEPQGSTSAQPDEQLAQELAQEPGKQHQEPAR 772


>SB_36059| Best HMM Match : TolA (HMM E-Value=0.1)
          Length = 1936

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 13/50 (26%), Positives = 28/50 (56%)
 Frame = +2

Query: 158  EQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRL 307
            +++ E ++ K K P  Q   G+ +  G  H+E +  + ++ S+K + GR+
Sbjct: 1236 KRLEEEKNAKRKRPGQQGGPGSKEKKG--HEEKKEKKPEKSSDKLSSGRV 1283


>SB_27138| Best HMM Match : Ebp2 (HMM E-Value=1.8)
          Length = 841

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 4/95 (4%)
 Frame = +2

Query: 8    KGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKI----EQMFEL 175
            K  +  ++E LTK R D          + + WT D  I V L  +K  +I     Q+ +L
Sbjct: 735  KKEKFRVNEDLTKGRLDAIKAINVKLDIYKLWTIDVTIQVRLNKDKAKEIIHSLRQLKDL 794

Query: 176  QHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQ 280
            Q L  K    +      Q++   +  P  +QN  +
Sbjct: 795  QQLIEKVLDTENQN--EQNTEHLNSMPFSNQNNNE 827


>SB_49533| Best HMM Match : Ldh_2 (HMM E-Value=0)
          Length = 883

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +2

Query: 155 IEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           I ++ E+QHL+    S Q  + A +   K+HD   R  N+   E  AR R
Sbjct: 548 IRKLAEIQHLENVKQSEQALKEAAERVTKAHDR-ERDINRMVQELKARFR 596


>SB_22154| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = -1

Query: 254 VRHEISQMTEELLALFEPRETWFSDAEVQTSVQSYCVYYPGEGRLFSHLL 105
           V  +  Q T  ++++   R   +     Q  V  +   YP EGR F HL+
Sbjct: 4   VNDQQKQATVHIISMRRIRSWIYESRHRQIKVSLFSKGYPEEGRNFDHLI 53


>SB_59010| Best HMM Match : rve (HMM E-Value=0.0052)
          Length = 935

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           +M E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 554 EMGEPQGSTSAQPDEQLAQELAQEPGKQHQEPAR 587


>SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047)
          Length = 983

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           +M E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 682 RMEEPQGSTSARPDEQPAQELAQEPGKQHQEPAR 715


>SB_9870| Best HMM Match : GspM (HMM E-Value=1.9)
          Length = 522

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           +M E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 138 RMEEPQGSTSARPDEQPAQELAQEPGKQHQEPAR 171


>SB_4563| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1473

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +2

Query: 161  QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
            +M E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 985  EMGEPQGSTSAQPDEQLAQELAQEPGKQHQEPAR 1018


>SB_49753| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-30)
          Length = 321

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +2

Query: 41  TKSRHDVFLEARSHFGVKRCWTTDGKIIV 127
           TKS  +V + AR  +GV+R W+   ++++
Sbjct: 178 TKSIAEVLIVARGDWGVQRLWSNTFELLI 206


>SB_2704| Best HMM Match : TP2 (HMM E-Value=6.9)
          Length = 351

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           +M E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 178 EMEEPQGSTSAQPDEQFAQELAQEPGKQHQEPAR 211


>SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9)
          Length = 482

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           +M E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 71  EMEEPQGSTSAQPDEQLAQELAQEPGKRHQEPAR 104


>SB_56575| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 831

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +2

Query: 47  SRHDVFLEARSHFGVKRCWTTDGKIIVLL-PDNKRSKIEQMFELQHLKTKFP-SAQKAQG 220
           +R  + L AR     K  WT +GK+ +    D++   I +  +L HLK +    +Q+ + 
Sbjct: 204 TRSCLALSARHDLKFKFIWTQNGKVFLRKNSDSQAVLISKSQDLLHLKQREDHDSQEVES 263

Query: 221 APQSSGKSHD 250
           A  +  K+ D
Sbjct: 264 ANLTGTKAFD 273


>SB_53151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 490

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 16/61 (26%), Positives = 28/61 (45%)
 Frame = -1

Query: 377 RIDN*VFSVTSMNKFKIPPYYFRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           R+ N +  +TS +K ++   Y R    L +S+S +   +  V   +SQ   + L L    
Sbjct: 169 RVLNLMLDITSKHKHRLGQRYTRLFNQLSVSQSVSQSVSQSVSQSVSQSVSQSLTLIPVS 228

Query: 197 E 195
           E
Sbjct: 229 E 229


>SB_35426| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 533

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +2

Query: 41  TKSRHDVFLEARSHFGVKRCWTTDGKIIV 127
           TKS  +V + AR  +GV+R W+   ++++
Sbjct: 116 TKSIAEVLIVARGDWGVQRLWSNTFELLI 144


>SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14)
          Length = 908

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +2

Query: 41  TKSRHDVFLEARSHFGVKRCWTTDGKIIV 127
           TKS  +V + AR  +GV+R W+   ++++
Sbjct: 55  TKSIAEVLIVARGDWGVERLWSNTFELLI 83


>SB_8182| Best HMM Match : ATP-synt_E (HMM E-Value=1.8)
          Length = 520

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 16/52 (30%), Positives = 25/52 (48%)
 Frame = +2

Query: 149 SKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           +K+E +   Q  KTK P   K      + G S  EP++ +  + S + AR R
Sbjct: 178 TKLECVGAAQKQKTKQPQNGKTNAGNINQGTSEAEPKK-RTPKNSTRGARKR 228


>SB_6427| Best HMM Match : RBM1CTR (HMM E-Value=0.42)
          Length = 315

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +2

Query: 161 QMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRR 262
           +M E Q   +  P  Q AQ   Q  GK H EP R
Sbjct: 114 EMEEPQGSTSAQPDDQLAQELAQEPGKQHQEPAR 147


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,453,535
Number of Sequences: 59808
Number of extensions: 215962
Number of successful extensions: 805
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 777
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 805
length of database: 16,821,457
effective HSP length: 74
effective length of database: 12,395,665
effective search space used: 681761575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).