SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY330178-1|AAQ16284.1|  176|Anopheles gambiae odorant-binding pr...    26   1.2  
AJ618921-1|CAF02000.1|  172|Anopheles gambiae putative odorant-b...    26   1.2  
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    26   1.2  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    26   1.2  
AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsi...    26   1.2  
AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    25   3.6  
AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein p...    23   8.3  

>AY330178-1|AAQ16284.1|  176|Anopheles gambiae odorant-binding
           protein AgamOBP51 protein.
          Length = 176

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = +2

Query: 653 MILSLANCPCERWE 694
           M+ S+ NCP ERW+
Sbjct: 146 MVESMRNCPAERWD 159


>AJ618921-1|CAF02000.1|  172|Anopheles gambiae putative
           odorant-binding protein OBP5479 protein.
          Length = 172

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = +2

Query: 653 MILSLANCPCERWE 694
           M+ S+ NCP ERW+
Sbjct: 148 MVESMRNCPAERWD 161


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = +3

Query: 684  NVGNPTQSVRNRYSPS-GNLNPSKEPEHLSVPGERSMP 794
            N  N    + +   P+ G+L+PS      S PG RS+P
Sbjct: 1330 NSSNSKHDLMSPCKPTNGSLSPSATHSRFSTPGARSLP 1367


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1978

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = +3

Query: 684  NVGNPTQSVRNRYSPS-GNLNPSKEPEHLSVPGERSMP 794
            N  N    + +   P+ G+L+PS      S PG RS+P
Sbjct: 1327 NSSNSKHDLMSPCKPTNGSLSPSATHSRFSTPGARSLP 1364


>AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsive
           serine proteaselike protein protein.
          Length = 600

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = -1

Query: 278 WNSLCCPRST--RHFNSSQ*QRTRNFGKHSIDTAASTSTCHTLQTST 144
           +  +CCP++     F+++Q        KH +   A+TST  T  T+T
Sbjct: 114 YEEVCCPKNAFPEEFHATQ------VAKHDLSMGATTSTTSTTATTT 154


>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
            channel alpha subunitprotein.
          Length = 2139

 Score = 24.6 bits (51), Expect = 3.6
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = -2

Query: 256  VPPGISTRHNNNELEILVN--IASILQHPQVRVTHFKRQPLNLC**FTLKSRRNNRPKAH 83
            V P IS+ H  NELE+  +  +A  L    ++  +     +     FT+     N+ K +
Sbjct: 1093 VCPCISSEHGENELELTPDDILADGLLKKGIKEHNQLEVAIGDGMEFTIHGDLKNKAKKN 1152

Query: 82   DQLNNNEK 59
             Q+ NN K
Sbjct: 1153 KQIMNNSK 1160


>AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein
           protein.
          Length = 353

 Score = 23.4 bits (48), Expect = 8.3
 Identities = 15/59 (25%), Positives = 29/59 (49%)
 Frame = -2

Query: 199 IASILQHPQVRVTHFKRQPLNLC**FTLKSRRNNRPKAHDQLNNNEKAKHRSTKRNPKK 23
           +A +LQ  Q +    +RQP       T + ++  + + H Q +N  +A+ R   RN ++
Sbjct: 68  VAGMLQQQQQQ----QRQPQRQAVVGTQQQQQRRQQQQHQQRSNATQAQRREQLRNEQR 122


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 958,165
Number of Sequences: 2352
Number of extensions: 22534
Number of successful extensions: 48
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 47
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 84823812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).