SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z71480-1|CAA96104.1|  209|Anopheles gambiae GSTD2 protein protein.     24   4.3  
AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein ...    23   5.7  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    23   5.7  
AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          23   7.5  
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    23   7.5  
EF426178-1|ABO26421.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426177-1|ABO26420.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426176-1|ABO26419.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426175-1|ABO26418.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426174-1|ABO26417.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426173-1|ABO26416.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426172-1|ABO26415.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426171-1|ABO26414.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426170-1|ABO26413.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426169-1|ABO26412.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426168-1|ABO26411.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426167-1|ABO26410.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426164-1|ABO26407.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426162-1|ABO26405.1|  155|Anopheles gambiae unknown protein.         23   9.9  
EF426161-1|ABO26404.1|  155|Anopheles gambiae unknown protein.         23   9.9  
AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein...    23   9.9  

>Z71480-1|CAA96104.1|  209|Anopheles gambiae GSTD2 protein protein.
          Length = 209

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = -3

Query: 215 DGALLLSPSRKHFLFICVEPG 153
           DG+L+LS SR   +++C + G
Sbjct: 58  DGSLVLSESRAALIYLCDQYG 78


>AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein
           protein.
          Length = 680

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 16/54 (29%), Positives = 23/54 (42%)
 Frame = +3

Query: 387 NLFPHSELLFXRFRMRSSGXKRHQCGQFPLYNWTLSKQKLRTVRVLCGNRVTVC 548
           N F  S  L    R R +  + H+C +    +  LSK K R +R   G +   C
Sbjct: 190 NCFTTSGELIRHIRYRHTHERPHKCTECDYASVELSKLK-RHIRTHTGEKPFQC 242


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -3

Query: 158 PGST-PRCPSGTPSMSPQKGSPASQP 84
           PG+  PR  +G P    +KG PA  P
Sbjct: 195 PGNPGPRGYAGIPGTKGEKGEPARHP 220


>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = -1

Query: 193 LHGNTSCLFVLSLXVLRAVQAELHQCHHRRDLQLH 89
           LH   SC     +  L    A+LH C +R +  LH
Sbjct: 788 LHLAVSCNSEPIVKALLGAGAKLHYCDYRGNTPLH 822


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 17/47 (36%), Positives = 20/47 (42%)
 Frame = +1

Query: 127  VPLGQRGVLPGSTQINRKCFREGESRRAPSAGPMLPVAAVTRRPRAL 267
            V L  RG  P   + N   FR       P+ GP   +AA TRR   L
Sbjct: 1126 VHLCNRGQWPSWMKQNLPTFRPS----GPAMGPRTAMAAGTRRAHVL 1168


>EF426178-1|ABO26421.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426177-1|ABO26420.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426176-1|ABO26419.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426175-1|ABO26418.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426174-1|ABO26417.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426173-1|ABO26416.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426172-1|ABO26415.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426171-1|ABO26414.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426170-1|ABO26413.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426169-1|ABO26412.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426168-1|ABO26411.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426167-1|ABO26410.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426164-1|ABO26407.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426162-1|ABO26405.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>EF426161-1|ABO26404.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +2

Query: 62  FNFXSMCMAVKLEIPSVVTLMEFRLDSAE 148
           FN  SMC  ++  +PS + +++  L + E
Sbjct: 100 FNDKSMCSLIQSALPSEIRIVDCDLCTTE 128


>AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein
           coupled receptor protein.
          Length = 695

 Score = 22.6 bits (46), Expect = 9.9
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = +1

Query: 388 ICFHILNFCL 417
           ICF+ILN+C+
Sbjct: 541 ICFNILNWCM 550


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 651,213
Number of Sequences: 2352
Number of extensions: 13323
Number of successful extensions: 43
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 43
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57609459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).