SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC017586-1|AAH17586.2|  198|Homo sapiens CAPSL protein protein.       101   3e-21
X97966-1|CAA66609.1|  189|Homo sapiens calcyphosine protein.           94   4e-19
BC104766-1|AAI04767.1|  189|Homo sapiens calcyphosine protein.         94   4e-19
BC101513-1|AAI01514.1|  189|Homo sapiens calcyphosine protein.         94   4e-19
BC080599-1|AAH80599.1|  189|Homo sapiens calcyphosine protein.         94   4e-19
AK090469-1|BAC03450.1|  322|Homo sapiens FLJ00390 protein protein.     94   4e-19
AC004602-1|AAC14484.1|  189|Homo sapiens CAYP_HUMAN protein.           94   4e-19
BC011961-1|AAH11961.1|  164|Homo sapiens Similar to calcyphosine...    73   8e-13
AF172852-1|AAF66821.1|  146|Homo sapiens calmodulin-like skin pr...    47   6e-05
AL732437-2|CAI11030.1|  146|Homo sapiens calmodulin-like 5 protein.    46   1e-04
AK222744-1|BAD96464.1|  146|Homo sapiens calmodulin-like skin pr...    44   4e-04
U03270-1|AAC27343.1|  172|Homo sapiens centrin protein.                43   0.001
BC029515-1|AAH29515.1|  172|Homo sapiens centrin, EF-hand protei...    43   0.001
BC051805-1|AAH51805.1|  215|Homo sapiens calcium binding protein...    41   0.003
X72964-1|CAA51467.1|  172|Homo sapiens caltractin protein.             39   0.015
BT007256-1|AAP35920.1|  172|Homo sapiens centrin, EF-hand protei...    39   0.015
BC013873-1|AAH13873.1|  172|Homo sapiens centrin, EF-hand protei...    39   0.015
BC005334-1|AAH05334.1|  172|Homo sapiens centrin, EF-hand protei...    39   0.015
AY919675-1|AAW82436.1|  172|Homo sapiens centrin, EF-hand protei...    39   0.015
L20348-1|AAA02869.1|  109|Homo sapiens oncomodulin protein.            38   0.020
BC113706-1|AAI13707.1|  109|Homo sapiens oncomodulin protein.          38   0.020
BC113704-1|AAI13705.1|  109|Homo sapiens oncomodulin protein.          38   0.020
BC069550-1|AAH69550.1|  109|Homo sapiens oncomodulin protein.          38   0.020
BC069512-1|AAH69512.1|  109|Homo sapiens oncomodulin protein.          38   0.020
BC069468-1|AAH69468.1|  109|Homo sapiens oncomodulin protein.          38   0.020
BC020200-1|AAH20200.1|  219|Homo sapiens calneuron 1 protein.          38   0.020
AY007302-1|AAG09620.1|  219|Homo sapiens calcium-binding protein...    38   0.020
AF282250-1|AAK15155.1|  219|Homo sapiens calneuron 1 protein.          38   0.020
AC004967-1|AAQ96880.1|  109|Homo sapiens unknown protein.              38   0.020
Z97055-2|CAI20388.1| 1501|Homo sapiens protein ( Human DNA seque...    38   0.027
Z82201-1|CAI20274.1| 1501|Homo sapiens protein ( Human DNA seque...    38   0.027
BC039315-1|AAH39315.1| 1349|Homo sapiens EF-hand calcium binding...    38   0.027
AL118498-1|CAI19709.1| 1501|Homo sapiens protein ( Human DNA seq...    38   0.027
AL031843-1|CAI19936.1| 1501|Homo sapiens protein ( Human DNA seq...    38   0.027
AL023801-1|CAI22791.1| 1501|Homo sapiens protein ( Human DNA seq...    38   0.027
X13461-1|CAA31809.1|  149|Homo sapiens protein ( H.sapiens intro...    38   0.036
M58026-1|AAA36356.1|  149|Homo sapiens NB-1 protein.                   38   0.036
BC031889-1|AAH31889.1|  149|Homo sapiens calmodulin-like 3 protein.    38   0.036
AL732437-1|CAI11029.1|  149|Homo sapiens calmodulin-like 3 protein.    38   0.036
AL590005-3|CAI14988.1| 5457|Homo sapiens dystonin protein.             38   0.036
AL590005-2|CAI14989.1| 7543|Homo sapiens dystonin protein.             38   0.036
AL512448-3|CAI16610.1| 5144|Homo sapiens dystonin protein.             38   0.036
AL512448-2|CAI16608.1| 5457|Homo sapiens dystonin protein.             38   0.036
AL512448-1|CAI16609.1| 7543|Homo sapiens dystonin protein.             38   0.036
AL512422-3|CAI14342.1| 5457|Homo sapiens dystonin protein.             38   0.036
AL512422-2|CAI14341.1| 7543|Homo sapiens dystonin protein.             38   0.036
AL442071-4|CAH73671.1| 5938|Homo sapiens microtubule-actin cross...    38   0.036
AL442071-2|CAH73669.1| 4433|Homo sapiens microtubule-actin cross...    38   0.036
AL442071-1|CAH73668.1| 5430|Homo sapiens microtubule-actin cross...    38   0.036
AL365277-16|CAI16426.1|  454|Homo sapiens microtubule-actin cros...    38   0.036
AL365277-14|CAI16424.1|  542|Homo sapiens microtubule-actin cros...    38   0.036
AL365277-12|CAI16422.1| 5938|Homo sapiens microtubule-actin cros...    38   0.036
AL365277-10|CAI16420.1| 4433|Homo sapiens microtubule-actin cros...    38   0.036
AL365277-7|CAI16417.1| 5430|Homo sapiens microtubule-actin cross...    38   0.036
AL355477-1|CAH70156.1| 5430|Homo sapiens microtubule-actin cross...    38   0.036
AL137853-5|CAI21818.1|  454|Homo sapiens microtubule-actin cross...    38   0.036
AL137853-4|CAI21817.1|  542|Homo sapiens microtubule-actin cross...    38   0.036
AL137853-3|CAI21816.1| 5938|Homo sapiens microtubule-actin cross...    38   0.036
AL137853-2|CAI21815.1| 4433|Homo sapiens microtubule-actin cross...    38   0.036
AL137853-1|CAI21814.1| 5430|Homo sapiens microtubule-actin cross...    38   0.036
AL137008-4|CAI20332.1| 5144|Homo sapiens dystonin protein.             38   0.036
AL137008-3|CAI20331.1| 5457|Homo sapiens dystonin protein.             38   0.036
AL137008-2|CAI20330.1| 7543|Homo sapiens dystonin protein.             38   0.036
AL096710-4|CAI22045.1| 5144|Homo sapiens dystonin protein.             38   0.036
AL096710-3|CAI22043.1| 5457|Homo sapiens dystonin protein.             38   0.036
AL096710-2|CAI22044.1| 7543|Homo sapiens dystonin protein.             38   0.036
AK128617-1|BAC87532.1| 1372|Homo sapiens protein ( Homo sapiens ...    38   0.036
AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid anti...    38   0.036
AF317696-1|AAL09459.1| 5938|Homo sapiens macrophin 1 isoform 4 p...    38   0.036
AF141968-1|AAF06360.1| 5373|Homo sapiens trabeculin-alpha protein.     38   0.036
AB029290-1|BAA83821.1| 5430|Homo sapiens actin binding protein A...    38   0.036
AB018271-1|BAA34448.2| 1637|Homo sapiens KIAA0728 protein protein.     38   0.036
AB007934-1|BAA32310.3| 4433|Homo sapiens KIAA0465 protein protein.     38   0.036
BC036380-1|AAH36380.1| 1380|Homo sapiens KIAA0980 protein protein.     37   0.047
AL031672-2|CAI43018.1| 1382|Homo sapiens novel protein protein.        37   0.047
AB023197-1|BAA76824.1| 1406|Homo sapiens KIAA0980 protein protein.     37   0.047
AB051459-1|BAB33342.1|  395|Homo sapiens KIAA1672 protein protein.     37   0.062
X07897-1|CAA30736.1|  161|Homo sapiens protein ( Human mRNA for ...    36   0.11 
M37984-1|AAA36772.1|  161|Homo sapiens slow twitch skeletal/card...    36   0.11 
M30773-1|AAB08721.1|  170|Homo sapiens calcineurin B protein.          36   0.11 
CR541885-1|CAG46683.1|  161|Homo sapiens TNNC1 protein.                36   0.11 
CR541865-1|CAG46663.1|  161|Homo sapiens TNNC1 protein.                36   0.11 
CR456938-1|CAG33219.1|  170|Homo sapiens PPP3R1 protein.               36   0.11 
BC030244-1|AAH30244.1|  161|Homo sapiens troponin C type 1 (slow...    36   0.11 
BC027913-1|AAH27913.1|  170|Homo sapiens protein phosphatase 3 (...    36   0.11 
AY183476-1|AAO23957.1|  765|Homo sapiens HZGJ protein.                 36   0.11 
AF020769-1|AAB91994.1|  160|Homo sapiens cardiac ventricular tro...    36   0.11 
AC017083-3|AAY14715.1|  170|Homo sapiens unknown protein.              36   0.11 
U58773-1|AAF14336.1|  191|Homo sapiens calcium binding protein p...    36   0.14 
BT020072-1|AAV38875.1|  191|Homo sapiens programmed cell death 6...    36   0.14 
BC106706-1|AAI06707.1|  191|Homo sapiens programmed cell death 6...    36   0.14 
BC012384-1|AAH12384.1|  191|Homo sapiens programmed cell death 6...    36   0.14 
AK223366-1|BAD97086.1|  191|Homo sapiens programmed cell death 6...    36   0.14 
AF035606-1|AAC27697.1|  191|Homo sapiens calcium binding protein...    36   0.14 
Y12473-1|CAA73077.1|  167|Homo sapiens centrin protein.                35   0.25 
X98330-1|CAA66975.1| 4967|Homo sapiens ryanodine receptor 2 prot...    35   0.25 
CR450346-1|CAG29342.1|  167|Homo sapiens CETN3 protein.                35   0.25 
BT006688-1|AAP35334.1|  167|Homo sapiens centrin, EF-hand protei...    35   0.25 
BC112040-1|AAI12041.1|  167|Homo sapiens centrin 3 protein.            35   0.25 
BC093793-1|AAH93793.1|  167|Homo sapiens centrin, EF-hand protei...    35   0.25 
BC005383-1|AAH05383.1|  167|Homo sapiens centrin, EF-hand protei...    35   0.25 
AY566229-1|AAS67001.1|  181|Homo sapiens calglandulin-like prote...    35   0.25 
AL513130-1|CAI15936.1| 4965|Homo sapiens ryanodine receptor 2 (c...    35   0.25 
AL445473-1|CAH71393.1| 4965|Homo sapiens ryanodine receptor 2 (c...    35   0.25 
AL442065-1|CAI15350.1| 4965|Homo sapiens ryanodine receptor 2 (c...    35   0.25 
AL391809-1|CAI14440.1| 4965|Homo sapiens ryanodine receptor 2 (c...    35   0.25 
AL365332-1|CAH71369.1| 4965|Homo sapiens ryanodine receptor 2 (c...    35   0.25 
AL359924-1|CAI22065.1| 4965|Homo sapiens ryanodine receptor 2 (c...    35   0.25 
AL356773-1|CAH73918.1| 4965|Homo sapiens ryanodine receptor 2 (c...    35   0.25 
AL109917-7|CAM12839.1|  181|Homo sapiens calmodulin-like 6 protein.    35   0.25 
AL109917-6|CAI95655.1|  164|Homo sapiens calmodulin-like 6 protein.    35   0.25 
AJ300340-1|CAC18855.1| 4967|Homo sapiens ryanodine receptor 2 pr...    35   0.25 
AF490905-1|AAM08411.2|  181|Homo sapiens calglandulin-like prote...    35   0.25 
BC113950-1|AAI13951.1| 1655|Homo sapiens phospholipase C, eta 1 ...    34   0.33 
AY691171-1|AAW22608.1| 1693|Homo sapiens phospholipase C-eta1b p...    34   0.33 
AY691170-1|AAW22607.1| 1002|Homo sapiens phospholipase C-eta1a p...    34   0.33 
AF023456-1|AAB82796.1|  753|Homo sapiens protein phosphatase wit...    34   0.33 
D16227-1|BAA03754.1|  193|Homo sapiens BDR-1 protein protein.          34   0.44 
BC113636-1|AAI13637.1|  218|Homo sapiens G protein-coupled recep...    34   0.44 
BC113634-1|AAI13635.1|  218|Homo sapiens G protein-coupled recep...    34   0.44 
BC028198-1|AAH28198.1|  669|Homo sapiens EF-hand domain family, ...    34   0.44 
AL355518-3|CAI13875.1|  218|Homo sapiens protein ( Human DNA seq...    34   0.44 
AK122616-1|BAC85491.1|  703|Homo sapiens protein ( Homo sapiens ...    34   0.44 
AK026337-1|BAB15452.1|  218|Homo sapiens protein ( Homo sapiens ...    34   0.44 
U94728-1|AAC83174.1|  149|Homo sapiens calmodulin protein.             33   0.58 
U12022-1|AAB60644.1|  149|Homo sapiens calmodulin protein.             33   0.58 
M27319-1|AAA35635.1|  149|Homo sapiens calmodulin protein.             33   0.58 
M19311-1|AAA35641.1|  149|Homo sapiens protein ( Human calmoduli...    33   0.58 
J04046-1|AAA51918.1|  149|Homo sapiens CALM1 protein.                  33   0.58 
D45887-1|BAA08302.1|  149|Homo sapiens calmodulin protein.             33   0.58 
CR542021-1|CAG46818.1|  149|Homo sapiens CALM2 protein.                33   0.58 
CR541990-1|CAG46787.1|  149|Homo sapiens CALM2 protein.                33   0.58 
BT009916-1|AAP88918.1|  149|Homo sapiens calmodulin 2 (phosphory...    33   0.58 
BT006855-1|AAP35501.1|  149|Homo sapiens calmodulin 3 (phosphory...    33   0.58 
BT006818-1|AAP35464.1|  149|Homo sapiens calmodulin 1 (phosphory...    33   0.58 
BC047523-1|AAH47523.1|  149|Homo sapiens CALM1 protein protein.        33   0.58 
BC039172-1|AAH39172.1|  146|Homo sapiens calmodulin-like 5 protein.    33   0.58 
BC026065-1|AAH26065.1|  149|Homo sapiens calmodulin 2 (phosphory...    33   0.58 
BC018677-1|AAH18677.1|  149|Homo sapiens calmodulin 2 (phosphory...    33   0.58 
BC017385-1|AAH17385.1|  149|Homo sapiens calmodulin 2 (phosphory...    33   0.58 
BC011834-1|AAH11834.1|  149|Homo sapiens calmodulin 1 (phosphory...    33   0.58 
BC008597-1|AAH08597.1|  149|Homo sapiens calmodulin 1 (phosphory...    33   0.58 
BC008437-1|AAH08437.1|  149|Homo sapiens calmodulin 2 (phosphory...    33   0.58 
BC006464-1|AAH06464.1|  149|Homo sapiens calmodulin 2 (phosphory...    33   0.58 
BC006182-1|AAH06182.1|  147|Homo sapiens CALM3 protein protein.        33   0.58 
BC005137-1|AAH05137.1|  149|Homo sapiens calmodulin 3 (phosphory...    33   0.58 
BC003354-1|AAH03354.1|  149|Homo sapiens calmodulin 2 (phosphory...    33   0.58 
BC000454-1|AAH00454.1|  149|Homo sapiens calmodulin 1 (phosphory...    33   0.58 
AC073283-2|AAY24085.1|  149|Homo sapiens unknown protein.              33   0.58 
AC006536-1|AAD45181.1|  149|Homo sapiens calmodulin protein.           33   0.58 
CR541975-1|CAG46773.1|  193|Homo sapiens HPCAL1 protein.               33   0.77 
BT009835-1|AAP88837.1|  193|Homo sapiens hippocalcin-like 1 prot...    33   0.77 
BC029358-1|AAH29358.1|  629|Homo sapiens GPR110 protein protein.       33   0.77 
BC017482-1|AAH17482.1|  193|Homo sapiens hippocalcin-like 1 prot...    33   0.77 
BC017028-1|AAH17028.1|  193|Homo sapiens hippocalcin-like 1 prot...    33   0.77 
BC009846-1|AAH09846.1|  193|Homo sapiens hippocalcin-like 1 prot...    33   0.77 
AL355518-2|CAI13874.1|  911|Homo sapiens protein ( Human DNA seq...    33   0.77 
AF085237-1|AAL40395.1|  170|Homo sapiens CNBII protein.                33   0.77 
AC007249-1|AAY15033.1|  193|Homo sapiens unknown protein.              33   0.77 
AB045123-1|BAD83599.1|  910|Homo sapiens KPG_012 protein protein.      33   0.77 
BC066299-1|AAH66299.1|  173|Homo sapiens protein phosphatase 3 (...    33   1.0  
BC030595-1|AAH30595.1|  173|Homo sapiens protein phosphatase 3 (...    33   1.0  
BC023566-1|AAH23566.1|  740|Homo sapiens RAS and EF-hand domain ...    33   1.0  
AL591377-1|CAH69961.1|  173|Homo sapiens protein phosphatase 3 (...    33   1.0  
AL499602-2|CAH70679.1|  189|Homo sapiens RAS and EF-hand domain ...    33   1.0  
AL499602-1|CAH70678.1|  740|Homo sapiens RAS and EF-hand domain ...    33   1.0  
AK057524-1|BAB71521.1|  173|Homo sapiens protein ( Homo sapiens ...    33   1.0  
AK056176-1|BAB71112.1|  189|Homo sapiens protein ( Homo sapiens ...    33   1.0  
AF400667-1|AAP57772.1|  173|Homo sapiens CBLP-like protein protein.    33   1.0  
AF145026-1|AAP97278.1|  170|Homo sapiens calcineurin B-like prot...    33   1.0  
BC110291-1|AAI10292.1|  189|Homo sapiens programmed cell death 6...    32   1.3  
D42073-1|BAA07670.1|  331|Homo sapiens reticulocalbin protein.         32   1.8  
BC063428-1|AAH63428.1|  193|Homo sapiens neurocalcin delta protein.    32   1.8  
BC036098-1|AAH36098.1|  193|Homo sapiens neurocalcin delta protein.    32   1.8  
BC033733-1|AAH33733.1|  702|Homo sapiens calpain 11 protein.           32   1.8  
BC010120-1|AAH10120.1|  331|Homo sapiens reticulocalbin 1, EF-ha...    32   1.8  
AY299331-1|AAP57260.1|  386|Homo sapiens EF-hand calcium binding...    32   1.8  
AL365192-3|CAI20532.2|  739|Homo sapiens calpain 11 protein.           32   1.8  
AK127376-1|BAC86948.1|  349|Homo sapiens protein ( Homo sapiens ...    32   1.8  
AJ242832-1|CAB52137.1|  702|Homo sapiens calpain protein.              32   1.8  
AF251061-1|AAK34951.1|  193|Homo sapiens neurocalcin protein.          32   1.8  
AB209015-1|BAD92252.1|  202|Homo sapiens Neurocalcin delta varia...    32   1.8  
X07898-1|CAA30737.1|  160|Homo sapiens protein ( Human mRNA for ...    31   2.3  
M33772-1|AAA61197.1|  160|Homo sapiens fast skeletal muscle trop...    31   2.3  
CR541884-1|CAG46682.1|  160|Homo sapiens TNNC2 protein.                31   2.3  
CR541864-1|CAG46662.1|  160|Homo sapiens TNNC2 protein.                31   2.3  
BX640702-1|CAE45822.1|   81|Homo sapiens hypothetical protein pr...    31   2.3  
BC009516-1|AAH09516.1|  120|Homo sapiens CALML4 protein protein.       31   2.3  
BC005323-1|AAH05323.1|  160|Homo sapiens troponin C type 2 (fast...    31   2.3  
AL050348-18|CAB66117.1|  160|Homo sapiens troponin C type 2 (fas...    31   2.3  
AL050348-17|CAC36110.1|  145|Homo sapiens troponin C type 2 (fas...    31   2.3  
AF308287-1|AAG48255.1|  256|Homo sapiens serologically defined b...    31   2.3  
AK128596-1|BAC87521.1|  973|Homo sapiens protein ( Homo sapiens ...    31   3.1  
AK127482-1|BAC86999.1| 1085|Homo sapiens protein ( Homo sapiens ...    31   3.1  
AB007859-1|BAA23695.4| 2982|Homo sapiens KIAA0399 protein protein.     31   3.1  
D16593-1|BAA04019.1|  193|Homo sapiens hippocalcin protein.            31   4.1  
BT019789-1|AAV38592.1|  193|Homo sapiens hippocalcin protein.          31   4.1  
BT019750-1|AAV38555.1|  193|Homo sapiens hippocalcin protein.          31   4.1  
BC001777-1|AAH01777.1|  193|Homo sapiens hippocalcin protein.          31   4.1  
AB046785-1|BAB13391.2| 1313|Homo sapiens KIAA1565 protein protein.     31   4.1  
AB015202-1|BAA74456.1|  193|Homo sapiens hippocalcin protein.          31   4.1  
M94547-1|AAA59889.1|  175|Homo sapiens atrial myosin light chain...    30   5.4  
M22307-1|AAA91854.1|  160|Homo sapiens troponin C protein.             30   5.4  
BC112230-1|AAI12231.1|  716|Homo sapiens macrophage expressed ge...    30   5.4  
BC104997-1|AAI04998.1|  716|Homo sapiens macrophage expressed ge...    30   5.4  
BC027915-1|AAH27915.1|  175|Homo sapiens myosin, light chain 7, ...    30   5.4  
AK074166-1|BAB84992.1|  717|Homo sapiens FLJ00239 protein protein.     30   5.4  
Z94056-2|CAI42777.1|  653|Homo sapiens protein phosphatase, EF-h...    30   7.2  
X97867-1|CAA66461.1|  653|Homo sapiens serine /threonine protein...    30   7.2  
X85030-1|CAA59403.1|  821|Homo sapiens calpain protein.                30   7.2  
DQ148492-1|AAZ77809.1|  233|Homo sapiens potassium channel inter...    30   7.2  
DQ148491-1|AAZ77808.1|  188|Homo sapiens potassium channel inter...    30   7.2  
DQ148490-1|AAZ77807.1|  225|Homo sapiens potassium channel inter...    30   7.2  
DQ148489-1|AAZ77806.1|  229|Homo sapiens potassium channel inter...    30   7.2  
DQ148488-1|AAZ77805.1|  216|Homo sapiens potassium channel inter...    30   7.2  
DQ148487-1|AAZ77804.1|  250|Homo sapiens potassium channel inter...    30   7.2  
BT007322-1|AAP35986.1|  309|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC146672-1|AAI46673.1|  821|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC146649-1|AAI46650.1|  821|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC128605-1|AAI28606.1|  156|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC107791-1|AAI07792.1|  156|Homo sapiens CAPN3 protein protein.        30   7.2  
BC100784-1|AAI00785.1|  156|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC100783-1|AAI00784.1|  174|Homo sapiens CAPN3 protein protein.        30   7.2  
BC100782-1|AAI00783.1|  156|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC067126-1|AAH67126.1|  156|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC036026-1|AAH36026.1|  653|Homo sapiens protein phosphatase, EF...    30   7.2  
BC032520-1|AAH32520.1|  250|Homo sapiens Kv channel interacting ...    30   7.2  
BC007810-1|AAH07810.3|  156|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC004883-1|AAH04883.1|  156|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC003521-1|AAH03521.1|  156|Homo sapiens calpain 3, (p94) protein.     30   7.2  
BC003169-1|AAH03169.1|  309|Homo sapiens calpain 3, (p94) protein.     30   7.2  
AY902237-1|AAW69391.1|  821|Homo sapiens calpain 3, (p94) protein.     30   7.2  
AY118170-1|AAM81578.1|  229|Homo sapiens potassium channel-inter...    30   7.2  
AY029176-1|AAK31594.1|  188|Homo sapiens KChIP4.3 variant protein.     30   7.2  
AL096700-2|CAI42857.1|  653|Homo sapiens protein phosphatase, EF...    30   7.2  
AF453246-1|AAL86769.1|  188|Homo sapiens potassium channel inter...    30   7.2  
AF367024-1|AAK53713.1|  216|Homo sapiens KCHIP4.2 protein.             30   7.2  
AF367023-1|AAK53712.1|  250|Homo sapiens KCHIP4.1 protein.             30   7.2  
AF305072-1|AAG36977.1|  250|Homo sapiens calsenilin-like protein...    30   7.2  
AF302044-1|AAG36974.1|  216|Homo sapiens calsenilin-like protein...    30   7.2  
AF209502-1|AAL40183.1|  821|Homo sapiens calpain protein.              30   7.2  
AF127765-1|AAD28254.3|  729|Homo sapiens calpain 3 protein.            30   7.2  
AF127764-1|AAD28253.1|  815|Homo sapiens calpain 3 protein.            30   7.2  
AF027977-1|AAC05825.1|  653|Homo sapiens serine/threonine protei...    30   7.2  
AF023455-1|AAB82795.1|  653|Homo sapiens protein phosphatase wit...    30   7.2  
AC104065-2|AAY40911.1|  107|Homo sapiens unknown protein.              30   7.2  
AB117940-1|BAD16649.1|  728|Homo sapiens hUp84 protein.                30   7.2  
U67280-1|AAB97725.1|  315|Homo sapiens calumenin protein.              29   9.5  
CR541835-1|CAG46634.1|  315|Homo sapiens CALU protein.                 29   9.5  
CR457039-1|CAG33320.1|  315|Homo sapiens CALU protein.                 29   9.5  
BT020143-1|AAV38945.1|  315|Homo sapiens calumenin protein.            29   9.5  
BT006826-1|AAP35472.1|  315|Homo sapiens calumenin protein.            29   9.5  
BC030201-1|AAH30201.2|  370|Homo sapiens calcium binding protein...    29   9.5  
BC013383-1|AAH13383.1|  315|Homo sapiens calumenin protein.            29   9.5  
AF345637-1|AAK72908.1|  315|Homo sapiens calumenin protein.            29   9.5  
AF257659-1|AAF76141.1|  296|Homo sapiens crocalbin-like protein ...    29   9.5  
AF169149-1|AAF25783.1|  227|Homo sapiens L-CaBP1 protein.              29   9.5  
AF169148-1|AAF25782.1|  167|Homo sapiens s-CaBP1 protein.              29   9.5  
AF013759-1|AAC17216.1|  315|Homo sapiens calumein protein.             29   9.5  

>BC017586-1|AAH17586.2|  198|Homo sapiens CAPSL protein protein.
          Length = 198

 Score =  101 bits (241), Expect = 3e-21
 Identities = 47/112 (41%), Positives = 75/112 (66%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RL CL+RG++GI GLGR+FR MDDD ++ L+ +EF+ G+ +  + + K E EELF +FD 
Sbjct: 20  RLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDK 79

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           D +G+I  +EFL+ +RPPMS +R+++  +  R L +       +  L+ VY+
Sbjct: 80  DGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYN 131


>X97966-1|CAA66609.1|  189|Homo sapiens calcyphosine protein.
          Length = 189

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 49/112 (43%), Positives = 72/112 (64%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R  CLSRGASGI GL R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D 
Sbjct: 12  RAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDR 71

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           + SG++ L+EFL  +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 72  NGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 123


>BC104766-1|AAI04767.1|  189|Homo sapiens calcyphosine protein.
          Length = 189

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 49/112 (43%), Positives = 72/112 (64%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R  CLSRGASGI GL R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D 
Sbjct: 12  RAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDR 71

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           + SG++ L+EFL  +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 72  NGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 123


>BC101513-1|AAI01514.1|  189|Homo sapiens calcyphosine protein.
          Length = 189

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 49/112 (43%), Positives = 72/112 (64%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R  CLSRGASGI GL R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D 
Sbjct: 12  RAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDR 71

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           + SG++ L+EFL  +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 72  NGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 123


>BC080599-1|AAH80599.1|  189|Homo sapiens calcyphosine protein.
          Length = 189

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 49/112 (43%), Positives = 72/112 (64%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R  CLSRGASGI GL R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D 
Sbjct: 12  RAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDR 71

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           + SG++ L+EFL  +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 72  NGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 123


>AK090469-1|BAC03450.1|  322|Homo sapiens FLJ00390 protein protein.
          Length = 322

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 49/112 (43%), Positives = 72/112 (64%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R  CLSRGASGI GL R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D 
Sbjct: 145 RAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDR 204

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           + SG++ L+EFL  +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 205 NGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 256


>AC004602-1|AAC14484.1|  189|Homo sapiens CAYP_HUMAN protein.
          Length = 189

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 49/112 (43%), Positives = 72/112 (64%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R  CLSRGASGI GL R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D 
Sbjct: 12  RAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDR 71

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           + SG++ L+EFL  +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 72  NGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 123


>BC011961-1|AAH11961.1|  164|Homo sapiens Similar to calcyphosine
           protein.
          Length = 164

 Score = 72.9 bits (171), Expect = 8e-13
 Identities = 38/98 (38%), Positives = 61/98 (62%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L R FR++D DGS+ L+ +EF  G+ + GL L+++EAE +  ++D + SG++ L+EFL  
Sbjct: 1   LARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRA 60

Query: 477 IRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
           +RPPMS++R  +       L R       +  L+GVYS
Sbjct: 61  LRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYS 98


>AF172852-1|AAF66821.1|  146|Homo sapiens calmodulin-like skin
           protein protein.
          Length = 146

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F  +D DG+  +N +E    +K TG  L++++  +L S+ D+D  G IS  EFL   R
Sbjct: 15  KAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAR 74



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = +3

Query: 258 LLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD 437
           L    +  +G+  L   FR  D DG   +  +E    +   G  L + E + +  + D D
Sbjct: 70  LTAARKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVD 129

Query: 438 SSGSISLDEF 467
             G ++ +EF
Sbjct: 130 QDGRVNYEEF 139


>AL732437-2|CAI11030.1|  146|Homo sapiens calmodulin-like 5 protein.
          Length = 146

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F  +D DG+  +N +E    +K TG  L++++  +L S+ D+D  G IS  EFL
Sbjct: 15  KAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFL 70



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = +3

Query: 258 LLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD 437
           L    +  +G+  L   FR  D DG   +  +E    +   G  L + E + +  + D D
Sbjct: 70  LTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVD 129

Query: 438 SSGSISLDEF 467
             G ++ +EF
Sbjct: 130 QDGRVNYEEF 139


>AK222744-1|BAD96464.1|  146|Homo sapiens calmodulin-like skin
           protein variant protein.
          Length = 146

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F  +D DG+  +N +E     K TG  L++++  +L S+ D+D  G IS  EFL
Sbjct: 15  KAFSAVDTDGNGTINAQELGAAPKATGKNLSEAQLRKLISEVDSDGDGEISFQEFL 70



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = +3

Query: 258 LLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD 437
           L    +  +G+  L   FR  D DG   +  +E    +   G  L + E + +  + D D
Sbjct: 70  LTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVD 129

Query: 438 SSGSISLDEF 467
             G ++ +EF
Sbjct: 130 QDGRVNYEEF 139


>U03270-1|AAC27343.1|  172|Homo sapiens centrin protein.
          Length = 172

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/67 (31%), Positives = 35/67 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DGS  ++ +E    ++  G E  K E +++ S+ D + +G IS ++FL  +   
Sbjct: 37  FDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>BC029515-1|AAH29515.1|  172|Homo sapiens centrin, EF-hand protein,
           1 protein.
          Length = 172

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/67 (31%), Positives = 35/67 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DGS  ++ +E    ++  G E  K E +++ S+ D + +G IS ++FL  +   
Sbjct: 37  FDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>BC051805-1|AAH51805.1|  215|Homo sapiens calcium binding protein 7
           protein.
          Length = 215

 Score = 41.1 bits (92), Expect = 0.003
 Identities = 18/64 (28%), Positives = 33/64 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DG+  ++K+E    ++  G   N+ E E +  + D D  G +  +EF+  + P 
Sbjct: 42  FKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPK 101

Query: 489 MSES 500
           +S S
Sbjct: 102 LSTS 105


>X72964-1|CAA51467.1|  172|Homo sapiens caltractin protein.
          Length = 172

 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG+  ++ +E    ++  G E  K E +++ S+ D + +G ++  +FL  +   
Sbjct: 37  FDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>BT007256-1|AAP35920.1|  172|Homo sapiens centrin, EF-hand protein,
           2 protein.
          Length = 172

 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG+  ++ +E    ++  G E  K E +++ S+ D + +G ++  +FL  +   
Sbjct: 37  FDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>BC013873-1|AAH13873.1|  172|Homo sapiens centrin, EF-hand protein,
           2 protein.
          Length = 172

 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG+  ++ +E    ++  G E  K E +++ S+ D + +G ++  +FL  +   
Sbjct: 37  FDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>BC005334-1|AAH05334.1|  172|Homo sapiens centrin, EF-hand protein,
           2 protein.
          Length = 172

 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG+  ++ +E    ++  G E  K E +++ S+ D + +G ++  +FL  +   
Sbjct: 37  FDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>AY919675-1|AAW82436.1|  172|Homo sapiens centrin, EF-hand protein,
           2 protein.
          Length = 172

 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG+  ++ +E    ++  G E  K E +++ S+ D + +G ++  +FL  +   
Sbjct: 37  FDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQK 96

Query: 489 MSESRRK 509
           MSE   K
Sbjct: 97  MSEKDTK 103


>L20348-1|AAA02869.1|  109|Homo sapiens oncomodulin protein.
          Length = 109

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>BC113706-1|AAI13707.1|  109|Homo sapiens oncomodulin protein.
          Length = 109

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>BC113704-1|AAI13705.1|  109|Homo sapiens oncomodulin protein.
          Length = 109

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>BC069550-1|AAH69550.1|  109|Homo sapiens oncomodulin protein.
          Length = 109

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>BC069512-1|AAH69512.1|  109|Homo sapiens oncomodulin protein.
          Length = 109

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>BC069468-1|AAH69468.1|  109|Homo sapiens oncomodulin protein.
          Length = 109

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>BC020200-1|AAH20200.1|  219|Homo sapiens calneuron 1 protein.
          Length = 219

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 17/64 (26%), Positives = 32/64 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           FR +D DG+  ++K+E    ++  G   ++ E   +  + D D  G +  DEF+  + P 
Sbjct: 45  FRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPK 104

Query: 489 MSES 500
           +  S
Sbjct: 105 LVSS 108


>AY007302-1|AAG09620.1|  219|Homo sapiens calcium-binding protein
           CABP8 protein.
          Length = 219

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 17/64 (26%), Positives = 32/64 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           FR +D DG+  ++K+E    ++  G   ++ E   +  + D D  G +  DEF+  + P 
Sbjct: 45  FRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPK 104

Query: 489 MSES 500
           +  S
Sbjct: 105 LVSS 108


>AF282250-1|AAK15155.1|  219|Homo sapiens calneuron 1 protein.
          Length = 219

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 17/64 (26%), Positives = 32/64 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           FR +D DG+  ++K+E    ++  G   ++ E   +  + D D  G +  DEF+  + P 
Sbjct: 45  FRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPK 104

Query: 489 MSES 500
           +  S
Sbjct: 105 LVSS 108


>AC004967-1|AAQ96880.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEE---FLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR +D+D S  L++EE   FL   +    EL +SE + L +  D D  G I  +EF
Sbjct: 47  VFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEF 103


>Z97055-2|CAI20388.1| 1501|Homo sapiens protein ( Human DNA sequence
            from clone RP3-388M5 on chromosome 22. ).
          Length = 1501

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L + F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K
Sbjct: 852  LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQK 911

Query: 477  I 479
            +
Sbjct: 912  L 912


>Z82201-1|CAI20274.1| 1501|Homo sapiens protein ( Human DNA sequence
            from clone RP3-345P10 on chromosome 22. ).
          Length = 1501

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L + F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K
Sbjct: 852  LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQK 911

Query: 477  I 479
            +
Sbjct: 912  L 912


>BC039315-1|AAH39315.1| 1349|Homo sapiens EF-hand calcium binding
           domain 6 protein.
          Length = 1349

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K
Sbjct: 700 LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQK 759

Query: 477 I 479
           +
Sbjct: 760 L 760


>AL118498-1|CAI19709.1| 1501|Homo sapiens protein ( Human DNA sequence
            from clone RP1-185D5 on chromosome 22. ).
          Length = 1501

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L + F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K
Sbjct: 852  LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQK 911

Query: 477  I 479
            +
Sbjct: 912  L 912


>AL031843-1|CAI19936.1| 1501|Homo sapiens protein ( Human DNA sequence
            from clone RP1-246D7 on chromosome 22q13.1-13.33.ontains
            GSSs.  ).
          Length = 1501

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L + F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K
Sbjct: 852  LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQK 911

Query: 477  I 479
            +
Sbjct: 912  L 912


>AL023801-1|CAI22791.1| 1501|Homo sapiens protein ( Human DNA sequence
            from clone RP4-786D3 on chromosome 22q13.31-33. ).
          Length = 1501

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +3

Query: 297  LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
            L + F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K
Sbjct: 852  LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQK 911

Query: 477  I 479
            +
Sbjct: 912  L 912


>X13461-1|CAA31809.1|  149|Homo sapiens protein ( H.sapiens
           intronless calmodulin-like gene (CLP gene) for
           calmodulin-like protein.  ).
          Length = 149

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+  ++  E  + +   G +L+  E +E+    DTD  G ++ +EF+
Sbjct: 90  FRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFV 143


>M58026-1|AAA36356.1|  149|Homo sapiens NB-1 protein.
          Length = 149

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+  ++  E  + +   G +L+  E +E+    DTD  G ++ +EF+
Sbjct: 90  FRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFV 143


>BC031889-1|AAH31889.1|  149|Homo sapiens calmodulin-like 3 protein.
          Length = 149

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+  ++  E  + +   G +L+  E +E+    DTD  G ++ +EF+
Sbjct: 90  FRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFV 143


>AL732437-1|CAI11029.1|  149|Homo sapiens calmodulin-like 3 protein.
          Length = 149

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D DG+  ++  E  + +   G +L+  E +E+    DTD  G ++ +EF+
Sbjct: 90  FRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFV 143


>AL590005-3|CAI14988.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 5093 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 5151


>AL590005-2|CAI14989.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 7179 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 7237


>AL512448-3|CAI16610.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 4767 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 4825


>AL512448-2|CAI16608.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 5093 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 5151


>AL512448-1|CAI16609.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 7179 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 7237


>AL512422-3|CAI14342.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 5093 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 5151


>AL512422-2|CAI14341.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 7179 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 7237


>AL442071-4|CAH73671.1| 5938|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5938

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5594 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5652


>AL442071-2|CAH73669.1| 4433|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 4433

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 4095 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 4153


>AL442071-1|CAH73668.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5092 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5150


>AL365277-16|CAI16426.1|  454|Homo sapiens microtubule-actin
           crosslinking factor 1 protein.
          Length = 454

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 73  FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 131


>AL365277-14|CAI16424.1|  542|Homo sapiens microtubule-actin
           crosslinking factor 1 protein.
          Length = 542

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 198 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 256


>AL365277-12|CAI16422.1| 5938|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5938

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5594 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5652


>AL365277-10|CAI16420.1| 4433|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 4433

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 4095 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 4153


>AL365277-7|CAI16417.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5092 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5150


>AL355477-1|CAH70156.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5092 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5150


>AL137853-5|CAI21818.1|  454|Homo sapiens microtubule-actin
           crosslinking factor 1 protein.
          Length = 454

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 73  FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 131


>AL137853-4|CAI21817.1|  542|Homo sapiens microtubule-actin
           crosslinking factor 1 protein.
          Length = 542

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 198 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 256


>AL137853-3|CAI21816.1| 5938|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5938

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5594 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5652


>AL137853-2|CAI21815.1| 4433|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 4433

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 4095 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 4153


>AL137853-1|CAI21814.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5092 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5150


>AL137008-4|CAI20332.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 4767 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 4825


>AL137008-3|CAI20331.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 5093 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 5151


>AL137008-2|CAI20330.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 7179 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 7237


>AL096710-4|CAI22045.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 4767 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 4825


>AL096710-3|CAI22043.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 5093 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 5151


>AL096710-2|CAI22044.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 7179 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 7237


>AK128617-1|BAC87532.1| 1372|Homo sapiens protein ( Homo sapiens cDNA
            FLJ46776 fis, clone TRACH3026650, highly  similar to
            Actin cross-linking family protein 7. ).
          Length = 1372

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 1034 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 1092


>AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid antigen 1
            eA protein.
          Length = 5171

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 4794 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 4852


>AF317696-1|AAL09459.1| 5938|Homo sapiens macrophin 1 isoform 4
            protein.
          Length = 5938

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5594 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5652


>AF141968-1|AAF06360.1| 5373|Homo sapiens trabeculin-alpha protein.
          Length = 5373

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5035 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5093


>AB029290-1|BAA83821.1| 5430|Homo sapiens actin binding protein ABP620
            protein.
          Length = 5430

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 5092 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 5150


>AB018271-1|BAA34448.2| 1637|Homo sapiens KIAA0728 protein protein.
          Length = 1637

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +    ++ E   +   FD D  G I   EF+  + P
Sbjct: 1260 FRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP 1318


>AB007934-1|BAA32310.3| 4433|Homo sapiens KIAA0465 protein protein.
          Length = 4433

 Score = 37.5 bits (83), Expect = 0.036
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            FRR+D D    + ++EF+ GI  +     K E   +   FD D  G I   EF+  + P
Sbjct: 4095 FRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHP 4153


>BC036380-1|AAH36380.1| 1380|Homo sapiens KIAA0980 protein protein.
          Length = 1380

 Score = 37.1 bits (82), Expect = 0.047
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEF 467
           L+++E     +  GL+ L K E E+LF++ D D  G +SL+EF
Sbjct: 216 LSEQELAVVCQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEF 258


>AL031672-2|CAI43018.1| 1382|Homo sapiens novel protein protein.
          Length = 1382

 Score = 37.1 bits (82), Expect = 0.047
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEF 467
           L+++E     +  GL+ L K E E+LF++ D D  G +SL+EF
Sbjct: 216 LSEQELAVVCQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEF 258


>AB023197-1|BAA76824.1| 1406|Homo sapiens KIAA0980 protein protein.
          Length = 1406

 Score = 37.1 bits (82), Expect = 0.047
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLE-LNKSEAEELFSQFDTDSSGSISLDEF 467
           L+++E     +  GL+ L K E E+LF++ D D  G +SL+EF
Sbjct: 240 LSEQELAVVCQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEF 282


>AB051459-1|BAB33342.1|  395|Homo sapiens KIAA1672 protein protein.
          Length = 395

 Score = 36.7 bits (81), Expect = 0.062
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           F   D++G+ +L + +    +    + L   E E+L++++DT+  G I+  EFL K+
Sbjct: 2   FLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKL 58


>X07897-1|CAA30736.1|  161|Homo sapiens protein ( Human mRNA for
           slow skeletal troponin C (TnC). ).
          Length = 161

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +FR  D +    ++ +E    ++ TG  + + + EEL    D ++ G I  DEFL
Sbjct: 97  LSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFL 154



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           L  +   +D+DGS  ++ +EFL  +     + +K ++EE    LF  FD ++ G I LDE
Sbjct: 57  LQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDE 116

Query: 465 FLIKIR 482
             I ++
Sbjct: 117 LKIMLQ 122


>M37984-1|AAA36772.1|  161|Homo sapiens slow twitch skeletal/cardiac
           muscle troponin C protein.
          Length = 161

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +FR  D +    ++ +E    ++ TG  + + + EEL    D ++ G I  DEFL
Sbjct: 97  LSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFL 154



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           L  +   +D+DGS  ++ +EFL  +     + +K ++EE    LF  FD ++ G I LDE
Sbjct: 57  LQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDE 116

Query: 465 FLIKIR 482
             I ++
Sbjct: 117 LKIMLQ 122


>M30773-1|AAB08721.1|  170|Homo sapiens calcineurin B protein.
          Length = 170

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C    A  I  LG+ F+++D D S  L+ EEF+  + E  L+ N    + +   FDTD 
Sbjct: 11  MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFM-SLPE--LQQNPL-VQRVIDIFDTDG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>CR541885-1|CAG46683.1|  161|Homo sapiens TNNC1 protein.
          Length = 161

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +FR  D +    ++ +E    ++ TG  + + + EEL    D ++ G I  DEFL
Sbjct: 97  LSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFL 154



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           L  +   +D+DGS  ++ +EFL  +     + +K ++EE    LF  FD ++ G I LDE
Sbjct: 57  LQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDE 116

Query: 465 FLIKIR 482
             I ++
Sbjct: 117 LKIMLQ 122


>CR541865-1|CAG46663.1|  161|Homo sapiens TNNC1 protein.
          Length = 161

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +FR  D +    ++ +E    ++ TG  + + + EEL    D ++ G I  DEFL
Sbjct: 97  LSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFL 154



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           L  +   +D+DGS  ++ +EFL  +     + +K ++EE    LF  FD ++ G I LDE
Sbjct: 57  LQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDE 116

Query: 465 FLIKIR 482
             I ++
Sbjct: 117 LKIMLQ 122


>CR456938-1|CAG33219.1|  170|Homo sapiens PPP3R1 protein.
          Length = 170

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C    A  I  LG+ F+++D D S  L+ EEF+  + E  L+ N    + +   FDTD 
Sbjct: 11  MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFM-SLPE--LQQNPL-VQRVIDIFDTDG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>BC030244-1|AAH30244.1|  161|Homo sapiens troponin C type 1 (slow)
           protein.
          Length = 161

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +FR  D +    ++ +E    ++ TG  + + + EEL    D ++ G I  DEFL
Sbjct: 97  LSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFL 154



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           L  +   +D+DGS  ++ +EFL  +     + +K ++EE    LF  FD ++ G I LDE
Sbjct: 57  LQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDE 116

Query: 465 FLIKIR 482
             I ++
Sbjct: 117 LKIMLQ 122


>BC027913-1|AAH27913.1|  170|Homo sapiens protein phosphatase 3
           (formerly 2B), regulatory subunit B, alpha isoform
           protein.
          Length = 170

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C    A  I  LG+ F+++D D S  L+ EEF+  + E  L+ N    + +   FDTD 
Sbjct: 11  MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFM-SLPE--LQQNPL-VQRVIDIFDTDG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>AY183476-1|AAO23957.1|  765|Homo sapiens HZGJ protein.
          Length = 765

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C    A  I  LG+ F+++D D S  L+ EEF+  + E  L+ N    + +   FDTD 
Sbjct: 74  MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFM-SLPE--LQQNPL-VQRVIDIFDTDG 129

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 130 NGEVDFKEFI 139


>AF020769-1|AAB91994.1|  160|Homo sapiens cardiac ventricular
           troponin C protein.
          Length = 160

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  +FR  D +    ++ +E    ++ TG  + + + EEL    D ++ G I  DEFL
Sbjct: 96  LSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFL 153



 Score = 35.5 bits (78), Expect = 0.14
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 3/65 (4%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEEL---FSQFDTDSSGSISLDEF 467
           L  +   +D+DGS  ++ +EFL  +     + +K ++EEL   F  FD ++ G I LDE 
Sbjct: 57  LQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEELSDLFRMFDKNADGYIDLDEL 116

Query: 468 LIKIR 482
            I ++
Sbjct: 117 KIMLQ 121


>AC017083-3|AAY14715.1|  170|Homo sapiens unknown protein.
          Length = 170

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C    A  I  LG+ F+++D D S  L+ EEF+  + E  L+ N    + +   FDTD 
Sbjct: 11  MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFM-SLPE--LQQNPL-VQRVIDIFDTDG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>U58773-1|AAF14336.1|  191|Homo sapiens calcium binding protein
           protein.
          Length = 191

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +   G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 152


>BT020072-1|AAV38875.1|  191|Homo sapiens programmed cell death 6
           protein.
          Length = 191

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +   G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 152


>BC106706-1|AAI06707.1|  191|Homo sapiens programmed cell death 6
           protein.
          Length = 191

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +   G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 152


>BC012384-1|AAH12384.1|  191|Homo sapiens programmed cell death 6
           protein.
          Length = 191

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +   G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 152


>AK223366-1|BAD97086.1|  191|Homo sapiens programmed cell death 6
           variant protein.
          Length = 191

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +   G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELRQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 152


>AF035606-1|AAC27697.1|  191|Homo sapiens calcium binding protein
           protein.
          Length = 191

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +   G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 152


>Y12473-1|CAA73077.1|  167|Homo sapiens centrin protein.
          Length = 167

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD S  ++        +E G  ++  E   +  +FD D  G I+ +EF+
Sbjct: 105 KAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI 160


>X98330-1|CAA66975.1| 4967|Homo sapiens ryanodine receptor 2 protein.
          Length = 4967

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4032 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4090

Query: 489  MSE 497
              +
Sbjct: 4091 AKD 4093


>CR450346-1|CAG29342.1|  167|Homo sapiens CETN3 protein.
          Length = 167

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD S  ++        +E G  ++  E   +  +FD D  G I+ +EF+
Sbjct: 105 KAFKLFDDDDSGKISLRNLRSVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI 160


>BT006688-1|AAP35334.1|  167|Homo sapiens centrin, EF-hand protein,
           3 (CDC31 homolog, yeast) protein.
          Length = 167

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD S  ++        +E G  ++  E   +  +FD D  G I+ +EF+
Sbjct: 105 KAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI 160


>BC112040-1|AAI12041.1|  167|Homo sapiens centrin 3 protein.
          Length = 167

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD S  ++        +E G  ++  E   +  +FD D  G I+ +EF+
Sbjct: 105 KAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI 160


>BC093793-1|AAH93793.1|  167|Homo sapiens centrin, EF-hand protein,
           3 (CDC31 homolog, yeast) protein.
          Length = 167

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD S  ++        +E G  ++  E   +  +FD D  G I+ +EF+
Sbjct: 105 KAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI 160


>BC005383-1|AAH05383.1|  167|Homo sapiens centrin, EF-hand protein,
           3 (CDC31 homolog, yeast) protein.
          Length = 167

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + F+  DDD S  ++        +E G  ++  E   +  +FD D  G I+ +EF+
Sbjct: 105 KAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI 160


>AY566229-1|AAS67001.1|  181|Homo sapiens calglandulin-like protein
           protein.
          Length = 181

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D +G   ++     Y +   G  LN+ EAE++  + D D   +I  +EF+
Sbjct: 116 FRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFV 169


>AL513130-1|CAI15936.1| 4965|Homo sapiens ryanodine receptor 2
            (cardiac) protein.
          Length = 4965

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4030 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4088

Query: 489  MSE 497
              +
Sbjct: 4089 AKD 4091


>AL445473-1|CAH71393.1| 4965|Homo sapiens ryanodine receptor 2
            (cardiac) protein.
          Length = 4965

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4030 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4088

Query: 489  MSE 497
              +
Sbjct: 4089 AKD 4091


>AL442065-1|CAI15350.1| 4965|Homo sapiens ryanodine receptor 2
            (cardiac) protein.
          Length = 4965

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4030 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4088

Query: 489  MSE 497
              +
Sbjct: 4089 AKD 4091


>AL391809-1|CAI14440.1| 4965|Homo sapiens ryanodine receptor 2
            (cardiac) protein.
          Length = 4965

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4030 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4088

Query: 489  MSE 497
              +
Sbjct: 4089 AKD 4091


>AL365332-1|CAH71369.1| 4965|Homo sapiens ryanodine receptor 2
            (cardiac) protein.
          Length = 4965

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4030 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4088

Query: 489  MSE 497
              +
Sbjct: 4089 AKD 4091


>AL359924-1|CAI22065.1| 4965|Homo sapiens ryanodine receptor 2
            (cardiac) protein.
          Length = 4965

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4030 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4088

Query: 489  MSE 497
              +
Sbjct: 4089 AKD 4091


>AL356773-1|CAH73918.1| 4965|Homo sapiens ryanodine receptor 2
            (cardiac) protein.
          Length = 4965

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4030 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4088

Query: 489  MSE 497
              +
Sbjct: 4089 AKD 4091


>AL109917-7|CAM12839.1|  181|Homo sapiens calmodulin-like 6 protein.
          Length = 181

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D +G   ++     Y +   G  LN+ EAE++  + D D   +I  +EF+
Sbjct: 116 FRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFV 169


>AL109917-6|CAI95655.1|  164|Homo sapiens calmodulin-like 6 protein.
          Length = 164

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D +G   ++     Y +   G  LN+ EAE++  + D D   +I  +EF+
Sbjct: 99  FRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFV 152


>AJ300340-1|CAC18855.1| 4967|Homo sapiens ryanodine receptor 2
            protein.
          Length = 4967

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = +3

Query: 309  FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
            F+  D DG  +++K +F +   E+     +SE E L S  +TD + ++  +EF+ +   P
Sbjct: 4032 FKEYDPDGKGVISKRDF-HKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEP 4090

Query: 489  MSE 497
              +
Sbjct: 4091 AKD 4093


>AF490905-1|AAM08411.2|  181|Homo sapiens calglandulin-like protein
           protein.
          Length = 181

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D +G   ++     Y +   G  LN+ EAE++  + D D   +I  +EF+
Sbjct: 116 FRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFV 169


>BC113950-1|AAI13951.1| 1655|Homo sapiens phospholipase C, eta 1
           protein.
          Length = 1655

 Score = 34.3 bits (75), Expect = 0.33
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD-SSGSISLDEFLI 473
           F   D +G  LLN EE    + +  + L + +  ++F + DTD + G+++ +EF +
Sbjct: 133 FEEADKNGDGLLNIEEIHQLMHKLNVNLPRRKVRQMFQEADTDENQGTLTFEEFCV 188


>AY691171-1|AAW22608.1| 1693|Homo sapiens phospholipase C-eta1b
           protein.
          Length = 1693

 Score = 34.3 bits (75), Expect = 0.33
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD-SSGSISLDEFLI 473
           F   D +G  LLN EE    + +  + L + +  ++F + DTD + G+++ +EF +
Sbjct: 151 FEEADKNGDGLLNIEEIHQLMHKLNVNLPRRKVRQMFQEADTDENQGTLTFEEFCV 206


>AY691170-1|AAW22607.1| 1002|Homo sapiens phospholipase C-eta1a
           protein.
          Length = 1002

 Score = 34.3 bits (75), Expect = 0.33
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD-SSGSISLDEFLI 473
           F   D +G  LLN EE    + +  + L + +  ++F + DTD + G+++ +EF +
Sbjct: 151 FEEADKNGDGLLNIEEIHQLMHKLNVNLPRRKVRQMFQEADTDENQGTLTFEEFCV 206


>AF023456-1|AAB82796.1|  753|Homo sapiens protein phosphatase with
           EF-hands-2 long form protein.
          Length = 753

 Score = 34.3 bits (75), Expect = 0.33
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L++E     + ET L  N+S  E +F   D+D SG ISLDEF
Sbjct: 637 LSRENIQSSLLET-LYRNRSNLETIFRIIDSDHSGFISLDEF 677


>D16227-1|BAA03754.1|  193|Homo sapiens BDR-1 protein protein.
          Length = 193

 Score = 33.9 bits (74), Expect = 0.44
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+ G+  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDTNGDGTIDFREFIIGLSVTRGGKLEQKLKWAFSMYDLDGNGYISRSEML 122


>BC113636-1|AAI13637.1|  218|Homo sapiens G protein-coupled receptor
           110 protein.
          Length = 218

 Score = 33.9 bits (74), Expect = 0.44
 Identities = 33/138 (23%), Positives = 54/138 (39%), Gaps = 5/138 (3%)
 Frame = +3

Query: 99  LLQLREFAKSKS*NGELSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLCLSRG 278
           +++ +      S NG L C  +    WF P    D + C  +      S E  L  LS+ 
Sbjct: 85  IIRAKATTDCNSLNGVLQCTCEDSYTWF-PPSCLDPQNCYLHTAGALPSCECHLNNLSQS 143

Query: 279 A-----SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
                 + I G  +I  R  +D   LLN    +Y     G+E+   +A E    F+    
Sbjct: 144 VNFCERTKIWGTFKINERFTND---LLNSSSAIYSKYANGIEIQLKKAYERIQGFE---- 196

Query: 444 GSISLDEFLIKIRPPMSE 497
            S+ + +F + +  P  E
Sbjct: 197 -SVQVTQFRMSLLSPKLE 213


>BC113634-1|AAI13635.1|  218|Homo sapiens G protein-coupled receptor
           110 protein.
          Length = 218

 Score = 33.9 bits (74), Expect = 0.44
 Identities = 33/138 (23%), Positives = 54/138 (39%), Gaps = 5/138 (3%)
 Frame = +3

Query: 99  LLQLREFAKSKS*NGELSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLCLSRG 278
           +++ +      S NG L C  +    WF P    D + C  +      S E  L  LS+ 
Sbjct: 85  IIRAKATTDCNSLNGVLQCTCEDSYTWF-PPSCLDPQNCYLHTAGALPSCECHLNNLSQS 143

Query: 279 A-----SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
                 + I G  +I  R  +D   LLN    +Y     G+E+   +A E    F+    
Sbjct: 144 VNFCERTKIWGTFKINERFTND---LLNSSSAIYSKYANGIEIQLKKAYERIQGFE---- 196

Query: 444 GSISLDEFLIKIRPPMSE 497
            S+ + +F + +  P  E
Sbjct: 197 -SVQVTQFRMSLLSPKLE 213


>BC028198-1|AAH28198.1|  669|Homo sapiens EF-hand domain family,
           member B protein.
          Length = 669

 Score = 33.9 bits (74), Expect = 0.44
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           FR  D  G  +++K+E      +  L L+    ++LF   D D+ G I+  EF
Sbjct: 406 FRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEF 458


>AL355518-3|CAI13875.1|  218|Homo sapiens protein ( Human DNA
           sequence from clone RP11-39C2 on chromosome 6 Contains
           thegene for a novel protein.  ).
          Length = 218

 Score = 33.9 bits (74), Expect = 0.44
 Identities = 33/138 (23%), Positives = 54/138 (39%), Gaps = 5/138 (3%)
 Frame = +3

Query: 99  LLQLREFAKSKS*NGELSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLCLSRG 278
           +++ +      S NG L C  +    WF P    D + C  +      S E  L  LS+ 
Sbjct: 85  IIRAKATTDCNSLNGVLQCTCEDSYTWF-PPSCLDPQNCYLHTAGALPSCECHLNNLSQS 143

Query: 279 A-----SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
                 + I G  +I  R  +D   LLN    +Y     G+E+   +A E    F+    
Sbjct: 144 VNFCERTKIWGTFKINERFTND---LLNSSSAIYSKYANGIEIQLKKAYERIQGFE---- 196

Query: 444 GSISLDEFLIKIRPPMSE 497
            S+ + +F + +  P  E
Sbjct: 197 -SVQVTQFRMSLLSPKLE 213


>AK122616-1|BAC85491.1|  703|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16028 fis, clone HLUNG2002958. ).
          Length = 703

 Score = 33.9 bits (74), Expect = 0.44
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           FR  D  G  +++K+E      +  L L+    ++LF   D D+ G I+  EF
Sbjct: 440 FRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEF 492


>AK026337-1|BAB15452.1|  218|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22684 fis, clone HSI10821. ).
          Length = 218

 Score = 33.9 bits (74), Expect = 0.44
 Identities = 33/138 (23%), Positives = 54/138 (39%), Gaps = 5/138 (3%)
 Frame = +3

Query: 99  LLQLREFAKSKS*NGELSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLCLSRG 278
           +++ +      S NG L C  +    WF P    D + C  +      S E  L  LS+ 
Sbjct: 85  IIRAKATTDCNSLNGVLQCTCEDSYTWF-PPSCLDPQNCYLHTAGALPSCECHLNNLSQS 143

Query: 279 A-----SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
                 + I G  +I  R  +D   LLN    +Y     G+E+   +A E    F+    
Sbjct: 144 VNFCERTKIWGTFKINERFTND---LLNSSSAIYSKYANGIEIQLKKAYERIQGFE---- 196

Query: 444 GSISLDEFLIKIRPPMSE 497
            S+ + +F + +  P  E
Sbjct: 197 -SVQVTQFRMSLLSPKLE 213


>U94728-1|AAC83174.1|  149|Homo sapiens calmodulin protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>U12022-1|AAB60644.1|  149|Homo sapiens calmodulin protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>M27319-1|AAA35635.1|  149|Homo sapiens calmodulin protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>M19311-1|AAA35641.1|  149|Homo sapiens protein ( Human calmodulin
           mRNA, complete cds. ).
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>J04046-1|AAA51918.1|  149|Homo sapiens CALM1 protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>D45887-1|BAA08302.1|  149|Homo sapiens calmodulin protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>CR542021-1|CAG46818.1|  149|Homo sapiens CALM2 protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>CR541990-1|CAG46787.1|  149|Homo sapiens CALM2 protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BT009916-1|AAP88918.1|  149|Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BT006855-1|AAP35501.1|  149|Homo sapiens calmodulin 3
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BT006818-1|AAP35464.1|  149|Homo sapiens calmodulin 1
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC047523-1|AAH47523.1|  149|Homo sapiens CALM1 protein protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC039172-1|AAH39172.1|  146|Homo sapiens calmodulin-like 5 protein.
          Length = 146

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = +3

Query: 258 LLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTD 437
           L    +  +G+  L   FR  D DG   +  +E    +   G  L + E + +  + D D
Sbjct: 70  LTAARKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVD 129

Query: 438 SSGSISLDEF 467
             G ++ +EF
Sbjct: 130 QDGRVNYEEF 139


>BC026065-1|AAH26065.1|  149|Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC018677-1|AAH18677.1|  149|Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC017385-1|AAH17385.1|  149|Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC011834-1|AAH11834.1|  149|Homo sapiens calmodulin 1
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC008597-1|AAH08597.1|  149|Homo sapiens calmodulin 1
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC008437-1|AAH08437.1|  149|Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC006464-1|AAH06464.1|  149|Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC006182-1|AAH06182.1|  147|Homo sapiens CALM3 protein protein.
          Length = 147

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC005137-1|AAH05137.1|  149|Homo sapiens calmodulin 3
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC003354-1|AAH03354.1|  149|Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>BC000454-1|AAH00454.1|  149|Homo sapiens calmodulin 1
           (phosphorylase kinase, delta) protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>AC073283-2|AAY24085.1|  149|Homo sapiens unknown protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>AC006536-1|AAD45181.1|  149|Homo sapiens calmodulin protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>CR541975-1|CAG46773.1|  193|Homo sapiens HPCAL1 protein.
          Length = 193

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEML 122


>BT009835-1|AAP88837.1|  193|Homo sapiens hippocalcin-like 1
           protein.
          Length = 193

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEML 122


>BC029358-1|AAH29358.1|  629|Homo sapiens GPR110 protein protein.
          Length = 629

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 5/117 (4%)
 Frame = +3

Query: 99  LLQLREFAKSKS*NGELSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLCLSRG 278
           +++ +      S NG L C  +    WF P    D + C  +      S E  L  LS+ 
Sbjct: 85  IIRAKATTDCNSLNGVLQCTCEDSYTWF-PPSCLDPQNCYLHTAGALPSCECHLNNLSQS 143

Query: 279 A-----SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
                 + I G  +I  R  +D   LLN    +Y     G+E+   +A E    F++
Sbjct: 144 VNFCERTKIWGTFKINERFTND---LLNSSSAIYSKYANGIEIQLKKAYERIQGFES 197


>BC017482-1|AAH17482.1|  193|Homo sapiens hippocalcin-like 1
           protein.
          Length = 193

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEML 122


>BC017028-1|AAH17028.1|  193|Homo sapiens hippocalcin-like 1
           protein.
          Length = 193

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEML 122


>BC009846-1|AAH09846.1|  193|Homo sapiens hippocalcin-like 1
           protein.
          Length = 193

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEML 122


>AL355518-2|CAI13874.1|  911|Homo sapiens protein ( Human DNA
           sequence from clone RP11-39C2 on chromosome 6 Contains
           thegene for a novel protein.  ).
          Length = 911

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 5/117 (4%)
 Frame = +3

Query: 99  LLQLREFAKSKS*NGELSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLCLSRG 278
           +++ +      S NG L C  +    WF P    D + C  +      S E  L  LS+ 
Sbjct: 86  IIRAKATTDCNSLNGVLQCTCEDSYTWF-PPSCLDPQNCYLHTAGALPSCECHLNNLSQS 144

Query: 279 A-----SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
                 + I G  +I  R  +D   LLN    +Y     G+E+   +A E    F++
Sbjct: 145 VNFCERTKIWGTFKINERFTND---LLNSSSAIYSKYANGIEIQLKKAYERIQGFES 198


>AF085237-1|AAL40395.1|  170|Homo sapiens CNBII protein.
          Length = 170

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 23/71 (32%), Positives = 34/71 (47%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C       I  LGR F+++D D S  L+ EEF+  + E  L  N      +   FDTD 
Sbjct: 11  MCSHFNNDEIKRLGRRFKKLDLDKSGSLSVEEFM-SLPE--LRHNPL-VRRVIDVFDTDG 66

Query: 441 SGSISLDEFLI 473
            G +   EF++
Sbjct: 67  DGEVDFKEFIL 77


>AC007249-1|AAY15033.1|  193|Homo sapiens unknown protein.
          Length = 193

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEML 122


>AB045123-1|BAD83599.1|  910|Homo sapiens KPG_012 protein protein.
          Length = 910

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 5/117 (4%)
 Frame = +3

Query: 99  LLQLREFAKSKS*NGELSCVAQTDVCWFRPGGRADAKECSCYDTSY*SSGETRLLCLSRG 278
           +++ +      S NG L C  +    WF P    D + C  +      S E  L  LS+ 
Sbjct: 85  IIRAKATTDCNSLNGVLQCTCEDSYTWF-PPSCLDPQNCYLHTAGALPSCECHLNNLSQS 143

Query: 279 A-----SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
                 + I G  +I  R  +D   LLN    +Y     G+E+   +A E    F++
Sbjct: 144 VNFCERTKIWGTFKINERFTND---LLNSSSAIYSKYANGIEIQLKKAYERIQGFES 197


>BC066299-1|AAH66299.1|  173|Homo sapiens protein phosphatase 3
           (formerly 2B), regulatory subunit B, beta isoform
           protein.
          Length = 173

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           LGR F+++D D S  L+ EEF+  + E  L  N      +   FDTD  G +   EF++
Sbjct: 26  LGRRFKKLDLDKSGSLSVEEFM-SLPE--LRHNPL-VRRVIDVFDTDGDGEVDFKEFIL 80


>BC030595-1|AAH30595.1|  173|Homo sapiens protein phosphatase 3
           (formerly 2B), regulatory subunit B, beta isoform
           protein.
          Length = 173

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           LGR F+++D D S  L+ EEF+  + E  L  N      +   FDTD  G +   EF++
Sbjct: 26  LGRRFKKLDLDKSGSLSVEEFM-SLPE--LRHNPL-VRRVIDVFDTDGDGEVDFKEFIL 80


>BC023566-1|AAH23566.1|  740|Homo sapiens RAS and EF-hand domain
           containing protein.
          Length = 740

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  +F   D + S  L +EEF     E  L +  ++AE +F + D D  G+I+  EF
Sbjct: 13  LRSVFAACDANRSGRLEREEFRALCTE--LRVRPADAEAVFQRLDADRDGAITFQEF 67


>AL591377-1|CAH69961.1|  173|Homo sapiens protein phosphatase 3
           (formerly 2B), regulatory subunit B, beta isoform
           protein.
          Length = 173

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           LGR F+++D D S  L+ EEF+  + E  L  N      +   FDTD  G +   EF++
Sbjct: 26  LGRRFKKLDLDKSGSLSVEEFM-SLPE--LRHNPL-VRRVIDVFDTDGDGEVDFKEFIL 80


>AL499602-2|CAH70679.1|  189|Homo sapiens RAS and EF-hand domain
           containing protein.
          Length = 189

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  +F   D + S  L +EEF     E  L +  ++AE +F + D D  G+I+  EF
Sbjct: 13  LRSVFAACDANRSGRLEREEFRALCTE--LRVRPADAEAVFQRLDADRDGAITFQEF 67


>AL499602-1|CAH70678.1|  740|Homo sapiens RAS and EF-hand domain
           containing protein.
          Length = 740

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  +F   D + S  L +EEF     E  L +  ++AE +F + D D  G+I+  EF
Sbjct: 13  LRSVFAACDANRSGRLEREEFRALCTE--LRVRPADAEAVFQRLDADRDGAITFQEF 67


>AK057524-1|BAB71521.1|  173|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32962 fis, clone TESTI2008387, highly similar to
           CALCINEURIN B-LIKE PROTEIN. ).
          Length = 173

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           LGR F+++D D S  L+ EEF+  + E  L  N      +   FDTD  G +   EF++
Sbjct: 26  LGRRFKKLDLDKSGSLSVEEFM-SLPE--LRHNPL-VRRVIDVFDTDGDGEVDFKEFIL 80


>AK056176-1|BAB71112.1|  189|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31614 fis, clone NT2RI2002970. ).
          Length = 189

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  +F   D + S  L +EEF     E  L +  ++AE +F + D D  G+I+  EF
Sbjct: 13  LRSVFAACDANRSGRLEREEFRALCTE--LRVRPADAEAVFQRLDADRDGAITFQEF 67


>AF400667-1|AAP57772.1|  173|Homo sapiens CBLP-like protein protein.
          Length = 173

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           LGR F+++D D S  L+ EEF+  + E  L  N      +   FDTD  G +   EF++
Sbjct: 26  LGRRFKKLDLDKSGSLSVEEFM-SLPE--LRHNPL-VRRVIDVFDTDGDGEVDFKEFIL 80


>AF145026-1|AAP97278.1|  170|Homo sapiens calcineurin B-like protein
           CBLP protein.
          Length = 170

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           LGR F+++D D S  L+ EEF+  + E  L  N      +   FDTD  G +   EF++
Sbjct: 23  LGRRFKKLDLDKSGSLSVEEFM-SLPE--LRHNPL-VRRVIDVFDTDGDGEVDFKEFIL 77


>BC110291-1|AAI10292.1|  189|Homo sapiens programmed cell death 6
           protein.
          Length = 189

 Score = 32.3 bits (70), Expect = 1.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D D S +++K E    +  +G  L+    + L  +FD    G I+ D+F+
Sbjct: 98  VFRTYDRDNSGMIDKNELKQAL--SGYRLSDQFHDILIRKFDRQGRGQIAFDDFI 150


>D42073-1|BAA07670.1|  331|Homo sapiens reticulocalbin protein.
          Length = 331

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/57 (28%), Positives = 26/57 (45%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           LG+I  R+D+DG   +  EE    IK            +++  +D D    IS +E+
Sbjct: 84  LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY 140


>BC063428-1|AAH63428.1|  193|Homo sapiens neurocalcin delta protein.
          Length = 193

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEML 122


>BC036098-1|AAH36098.1|  193|Homo sapiens neurocalcin delta protein.
          Length = 193

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEML 122


>BC033733-1|AAH33733.1|  702|Homo sapiens calpain 11 protein.
          Length = 702

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IFR  D D S  LN  E    I++ G++LN    + L +++  D    I  D F+
Sbjct: 611 IFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARY-ADDDLIIDFDSFI 664


>BC010120-1|AAH10120.1|  331|Homo sapiens reticulocalbin 1, EF-hand
           calcium binding domain protein.
          Length = 331

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/57 (28%), Positives = 26/57 (45%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           LG+I  R+D+DG   +  EE    IK            +++  +D D    IS +E+
Sbjct: 84  LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY 140


>AY299331-1|AAP57260.1|  386|Homo sapiens EF-hand calcium binding
           protein 2 protein.
          Length = 386

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           IFRR D +    L+ EEF     + G+ LN+ E E+LF   D+D++  +   E
Sbjct: 68  IFRRADKNDDGKLSLEEFQLFFAD-GV-LNEKELEDLFHTIDSDNTNHVDTKE 118


>AL365192-3|CAI20532.2|  739|Homo sapiens calpain 11 protein.
          Length = 739

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IFR  D D S  LN  E    I++ G++LN    + L +++  D    I  D F+
Sbjct: 648 IFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARY-ADDDLIIDFDSFI 701


>AK127376-1|BAC86948.1|  349|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45452 fis, clone BRSTN2006638, weakly  similar
           to Rattus norvegicus synaptotagmin interacting protein 1
           (Stip-1). ).
          Length = 349

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           IFRR D +    L+ EEF     + G+ LN+ E E+LF   D+D++  +   E
Sbjct: 31  IFRRADKNDDGKLSLEEFQLFFAD-GV-LNEKELEDLFHTIDSDNTNHVDTKE 81


>AJ242832-1|CAB52137.1|  702|Homo sapiens calpain protein.
          Length = 702

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IFR  D D S  LN  E    I++ G++LN    + L +++  D    I  D F+
Sbjct: 611 IFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARY-ADDDLIIDFDSFI 664


>AF251061-1|AAK34951.1|  193|Homo sapiens neurocalcin protein.
          Length = 193

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEML 122


>AB209015-1|BAD92252.1|  202|Homo sapiens Neurocalcin delta variant
           protein.
          Length = 202

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L
Sbjct: 73  VFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEML 127


>X07898-1|CAA30737.1|  160|Homo sapiens protein ( Human mRNA for
           fast skeletal troponin C. ).
          Length = 160

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I  +E
Sbjct: 56  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEE 115


>M33772-1|AAA61197.1|  160|Homo sapiens fast skeletal muscle
           troponin C protein.
          Length = 160

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I  +E
Sbjct: 56  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEE 115


>CR541884-1|CAG46682.1|  160|Homo sapiens TNNC2 protein.
          Length = 160

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I  +E
Sbjct: 56  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEE 115


>CR541864-1|CAG46662.1|  160|Homo sapiens TNNC2 protein.
          Length = 160

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I  +E
Sbjct: 56  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEE 115


>BX640702-1|CAE45822.1|   81|Homo sapiens hypothetical protein
           protein.
          Length = 81

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +3

Query: 381 GLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           G +L   E ++LF + D + +G +  DEF+ KI  P
Sbjct: 42  GEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLP 77


>BC009516-1|AAH09516.1|  120|Homo sapiens CALML4 protein protein.
          Length = 120

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +3

Query: 381 GLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           G +L   E ++LF + D + +G +  DEF+ KI  P
Sbjct: 81  GEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLP 116


>BC005323-1|AAH05323.1|  160|Homo sapiens troponin C type 2 (fast)
           protein.
          Length = 160

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I  +E
Sbjct: 56  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEE 115


>AL050348-18|CAB66117.1|  160|Homo sapiens troponin C type 2 (fast)
           protein.
          Length = 160

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I  +E
Sbjct: 56  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEE 115


>AL050348-17|CAC36110.1|  145|Homo sapiens troponin C type 2 (fast)
           protein.
          Length = 145

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I  +E
Sbjct: 41  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEE 100


>AF308287-1|AAG48255.1|  256|Homo sapiens serologically defined
           breast cancer antigen NY-BR-20 protein.
          Length = 256

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +3

Query: 381 GLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           G +L   E ++LF + D + +G +  DEF+ KI  P
Sbjct: 217 GEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLP 252


>AK128596-1|BAC87521.1|  973|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46755 fis, clone TRACH3023373, highly  similar
           to Colorectal mutant cancer protein. ).
          Length = 973

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R+F+  D DG   +++ + L   ++  +E       E+ +Q   D +G IS  +F
Sbjct: 46  RLFQTCDGDGDGYISRNDLLMVCRQLNME---ESVAEIMNQLGADENGKISFQDF 97


>AK127482-1|BAC86999.1| 1085|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45574 fis, clone BRTHA3011187. ).
          Length = 1085

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 3/60 (5%)
 Frame = +3

Query: 300 GRIFRRMDDD---GSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           G +FR +++    G + +  E+F   ++  G   +  + EE F+QFD +  G++  +  L
Sbjct: 78  GALFRWLEERLGRGEESVTLEQFRELLEARGAGCSSEQFEEAFAQFDAEGDGTVDAENML 137


>AB007859-1|BAA23695.4| 2982|Homo sapiens KIAA0399 protein protein.
          Length = 2982

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 3/60 (5%)
 Frame = +3

Query: 300 GRIFRRMDDD---GSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           G +FR +++    G + +  E+F   ++  G   +  + EE F+QFD +  G++  +  L
Sbjct: 99  GALFRWLEERLGRGEESVTLEQFRELLEARGAGCSSEQFEEAFAQFDAEGDGTVDAENML 158


>D16593-1|BAA04019.1|  193|Homo sapiens hippocalcin protein.
          Length = 193

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 12/66 (18%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFL------YGIKETGLELNKSEA------EELFSQFDTDSSGSI 452
           F   D DG+  +++EE L      Y +  + +++ + E+      E++F Q DT++ G +
Sbjct: 105 FSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKL 164

Query: 453 SLDEFL 470
           SL+EF+
Sbjct: 165 SLEEFI 170



 Score = 29.9 bits (64), Expect = 7.2
 Identities = 15/55 (27%), Positives = 26/55 (47%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +    ++  EF+  +  T     + +    FS +D D +G IS +E L
Sbjct: 68  VFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEML 122



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +3

Query: 405 AEELFSQFDTDSSGSISLDEFLIKI 479
           AE +F  FDT+S G+I   EF+I +
Sbjct: 65  AEHVFRTFDTNSDGTIDFREFIIAL 89


>BT019789-1|AAV38592.1|  193|Homo sapiens hippocalcin protein.
          Length = 193

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 12/66 (18%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFL------YGIKETGLELNKSEA------EELFSQFDTDSSGSI 452
           F   D DG+  +++EE L      Y +  + +++ + E+      E++F Q DT++ G +
Sbjct: 105 FSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKL 164

Query: 453 SLDEFL 470
           SL+EF+
Sbjct: 165 SLEEFI 170



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/55 (27%), Positives = 26/55 (47%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +    ++  EF+  +  T     + +    FS +D D +G IS +E L
Sbjct: 68  VFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEML 122



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +3

Query: 405 AEELFSQFDTDSSGSISLDEFLIKI 479
           AE +F  FDT+S G+I   EF+I +
Sbjct: 65  AEHVFRTFDTNSDGTIDFREFIIAL 89


>BT019750-1|AAV38555.1|  193|Homo sapiens hippocalcin protein.
          Length = 193

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 12/66 (18%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFL------YGIKETGLELNKSEA------EELFSQFDTDSSGSI 452
           F   D DG+  +++EE L      Y +  + +++ + E+      E++F Q DT++ G +
Sbjct: 105 FSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKL 164

Query: 453 SLDEFL 470
           SL+EF+
Sbjct: 165 SLEEFI 170



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/55 (27%), Positives = 26/55 (47%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +    ++  EF+  +  T     + +    FS +D D +G IS +E L
Sbjct: 68  VFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEML 122



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +3

Query: 405 AEELFSQFDTDSSGSISLDEFLIKI 479
           AE +F  FDT+S G+I   EF+I +
Sbjct: 65  AEHVFRTFDTNSDGTIDFREFIIAL 89


>BC001777-1|AAH01777.1|  193|Homo sapiens hippocalcin protein.
          Length = 193

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 12/66 (18%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFL------YGIKETGLELNKSEA------EELFSQFDTDSSGSI 452
           F   D DG+  +++EE L      Y +  + +++ + E+      E++F Q DT++ G +
Sbjct: 105 FSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKL 164

Query: 453 SLDEFL 470
           SL+EF+
Sbjct: 165 SLEEFI 170



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/55 (27%), Positives = 26/55 (47%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +    ++  EF+  +  T     + +    FS +D D +G IS +E L
Sbjct: 68  VFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEML 122



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +3

Query: 405 AEELFSQFDTDSSGSISLDEFLIKI 479
           AE +F  FDT+S G+I   EF+I +
Sbjct: 65  AEHVFRTFDTNSDGTIDFREFIIAL 89


>AB046785-1|BAB13391.2| 1313|Homo sapiens KIAA1565 protein protein.
          Length = 1313

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +3

Query: 363 YGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           YG+ E   + +++  +ELF  FDT  +GS+  +E
Sbjct: 37  YGMDEVEQDQHEARLKELFDSFDTTGTGSLGQEE 70


>AB015202-1|BAA74456.1|  193|Homo sapiens hippocalcin protein.
          Length = 193

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 12/66 (18%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFL------YGIKETGLELNKSEA------EELFSQFDTDSSGSI 452
           F   D DG+  +++EE L      Y +  + +++ + E+      E++F Q DT++ G +
Sbjct: 105 FSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKL 164

Query: 453 SLDEFL 470
           SL+EF+
Sbjct: 165 SLEEFI 170



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/55 (27%), Positives = 26/55 (47%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +    ++  EF+  +  T     + +    FS +D D +G IS +E L
Sbjct: 68  VFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEML 122



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +3

Query: 405 AEELFSQFDTDSSGSISLDEFLIKI 479
           AE +F  FDT+S G+I   EF+I +
Sbjct: 65  AEHVFRTFDTNSDGTIDFREFIIAL 89


>M94547-1|AAA59889.1|  175|Homo sapiens atrial myosin light chain
           protein.
          Length = 175

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           FR  D  G  ++NK+EF   +     + + +E E++F+    D +G+I
Sbjct: 111 FRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNI 158


>M22307-1|AAA91854.1|  160|Homo sapiens troponin C protein.
          Length = 160

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 4/60 (6%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLY----GIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L  I   +D+DGS  ++ EEFL      +KE     ++ E  E F  FD ++ G I   E
Sbjct: 56  LDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPGE 115


>BC112230-1|AAI12231.1|  716|Homo sapiens macrophage expressed gene
           1 protein.
          Length = 716

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
 Frame = +3

Query: 315 RMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI-KIRPPM 491
           R  +DG  ++  E F    K++ LE+N SE  E ++ + + +S SI+ +  L  K+    
Sbjct: 71  RTTEDGQYIIPDEIFTIPQKQSNLEMN-SEILESWANYQSSTSYSINTELSLFSKVNGKF 129

Query: 492 SE--SRRKL*NKHSRSLTRLVTVQSQLMTLK 578
           S    R K      +++T  V V++ + T+K
Sbjct: 130 STEFQRMKTLQVKDQAITTRVQVRNLVYTVK 160


>BC104997-1|AAI04998.1|  716|Homo sapiens macrophage expressed gene
           1 protein.
          Length = 716

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
 Frame = +3

Query: 315 RMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI-KIRPPM 491
           R  +DG  ++  E F    K++ LE+N SE  E ++ + + +S SI+ +  L  K+    
Sbjct: 71  RTTEDGQYIIPDEIFTIPQKQSNLEMN-SEILESWANYQSSTSYSINTELSLFSKVNGKF 129

Query: 492 SE--SRRKL*NKHSRSLTRLVTVQSQLMTLK 578
           S    R K      +++T  V V++ + T+K
Sbjct: 130 STEFQRMKTLQVKDQAITTRVQVRNLVYTVK 160


>BC027915-1|AAH27915.1|  175|Homo sapiens myosin, light chain 7,
           regulatory protein.
          Length = 175

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           FR  D  G  ++NK+EF   +     + + +E E++F+    D +G+I
Sbjct: 111 FRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNI 158


>AK074166-1|BAB84992.1|  717|Homo sapiens FLJ00239 protein protein.
          Length = 717

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
 Frame = +3

Query: 315 RMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI-KIRPPM 491
           R  +DG  ++  E F    K++ LE+N SE  E ++ + + +S SI+ +  L  K+    
Sbjct: 72  RTTEDGQYIIPDEIFTIPQKQSNLEMN-SEILESWANYQSSTSYSINTELSLFSKVNGKF 130

Query: 492 SE--SRRKL*NKHSRSLTRLVTVQSQLMTLK 578
           S    R K      +++T  V V++ + T+K
Sbjct: 131 STEFQRMKTLQVKDQAITTRVQVRNLVYTVK 161


>Z94056-2|CAI42777.1|  653|Homo sapiens protein phosphatase, EF-hand
           calcium binding domain 1 protein.
          Length = 653

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIK----ETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF  +D D S L++ EEF    K       + ++ S+  +L +  D +  GSI  +EFL
Sbjct: 574 IFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFL 632



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEF 467
           +S+ E +F+  DTD SG IS++EF
Sbjct: 568 RSDLEIIFNAIDTDHSGLISVEEF 591


>X97867-1|CAA66461.1|  653|Homo sapiens serine /threonine protein
           phosphatase protein.
          Length = 653

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIK----ETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF  +D D S L++ EEF    K       + ++ S+  +L +  D +  GSI  +EFL
Sbjct: 574 IFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFL 632



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEF 467
           +S+ E +F+  DTD SG IS++EF
Sbjct: 568 RSDLEIIFNAIDTDHSGLISVEEF 591


>X85030-1|CAA59403.1|  821|Homo sapiens calpain protein.
          Length = 821

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 704 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 743


>DQ148492-1|AAZ77809.1|  233|Homo sapiens potassium channel
           interacting protein 4 protein.
          Length = 233

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 192 VETFFQKMDKNKDGVVTIDEFIESC 216


>DQ148491-1|AAZ77808.1|  188|Homo sapiens potassium channel
           interacting protein 4 protein.
          Length = 188

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 147 VETFFQKMDKNKDGVVTIDEFIESC 171


>DQ148490-1|AAZ77807.1|  225|Homo sapiens potassium channel
           interacting protein 4 protein.
          Length = 225

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 184 VETFFQKMDKNKDGVVTIDEFIESC 208


>DQ148489-1|AAZ77806.1|  229|Homo sapiens potassium channel
           interacting protein 4 protein.
          Length = 229

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 188 VETFFQKMDKNKDGVVTIDEFIESC 212


>DQ148488-1|AAZ77805.1|  216|Homo sapiens potassium channel
           interacting protein 4 protein.
          Length = 216

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 175 VETFFQKMDKNKDGVVTIDEFIESC 199


>DQ148487-1|AAZ77804.1|  250|Homo sapiens potassium channel
           interacting protein 4 protein.
          Length = 250

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 209 VETFFQKMDKNKDGVVTIDEFIESC 233


>BT007322-1|AAP35986.1|  309|Homo sapiens calpain 3, (p94) protein.
          Length = 309

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 192 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 231


>BC146672-1|AAI46673.1|  821|Homo sapiens calpain 3, (p94) protein.
          Length = 821

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 704 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 743


>BC146649-1|AAI46650.1|  821|Homo sapiens calpain 3, (p94) protein.
          Length = 821

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 704 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 743


>BC128605-1|AAI28606.1|  156|Homo sapiens calpain 3, (p94) protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC107791-1|AAI07792.1|  156|Homo sapiens CAPN3 protein protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC100784-1|AAI00785.1|  156|Homo sapiens calpain 3, (p94) protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC100783-1|AAI00784.1|  174|Homo sapiens CAPN3 protein protein.
          Length = 174

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC100782-1|AAI00783.1|  156|Homo sapiens calpain 3, (p94) protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC067126-1|AAH67126.1|  156|Homo sapiens calpain 3, (p94) protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC036026-1|AAH36026.1|  653|Homo sapiens protein phosphatase,
           EF-hand calcium binding domain 1 protein.
          Length = 653

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIK----ETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF  +D D S L++ EEF    K       + ++ S+  +L +  D +  GSI  +EFL
Sbjct: 574 IFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFL 632



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEF 467
           +S+ E +F+  DTD SG IS++EF
Sbjct: 568 RSDLEIIFNAIDTDHSGLISVEEF 591


>BC032520-1|AAH32520.1|  250|Homo sapiens Kv channel interacting
           protein 4 protein.
          Length = 250

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 209 VETFFQKMDKNKDGVVTIDEFIESC 233


>BC007810-1|AAH07810.3|  156|Homo sapiens calpain 3, (p94) protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC004883-1|AAH04883.1|  156|Homo sapiens calpain 3, (p94) protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC003521-1|AAH03521.1|  156|Homo sapiens calpain 3, (p94) protein.
          Length = 156

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 39  MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 78


>BC003169-1|AAH03169.1|  309|Homo sapiens calpain 3, (p94) protein.
          Length = 309

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 192 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 231


>AY902237-1|AAW69391.1|  821|Homo sapiens calpain 3, (p94) protein.
          Length = 821

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 704 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 743


>AY118170-1|AAM81578.1|  229|Homo sapiens potassium
           channel-interacting protein KCHIP4.4 protein.
          Length = 229

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 188 VETFFQKMDKNKDGVVTIDEFIESC 212


>AY029176-1|AAK31594.1|  188|Homo sapiens KChIP4.3 variant protein.
          Length = 188

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 147 VETFFQKMDKNKDGVVTIDEFIESC 171


>AL096700-2|CAI42857.1|  653|Homo sapiens protein phosphatase,
           EF-hand calcium binding domain 1 protein.
          Length = 653

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIK----ETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF  +D D S L++ EEF    K       + ++ S+  +L +  D +  GSI  +EFL
Sbjct: 574 IFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFL 632



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEF 467
           +S+ E +F+  DTD SG IS++EF
Sbjct: 568 RSDLEIIFNAIDTDHSGLISVEEF 591


>AF453246-1|AAL86769.1|  188|Homo sapiens potassium channel
           interacting protein 4b short isoform protein.
          Length = 188

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 147 VETFFQKMDKNKDGVVTIDEFIESC 171


>AF367024-1|AAK53713.1|  216|Homo sapiens KCHIP4.2 protein.
          Length = 216

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 175 VETFFQKMDKNKDGVVTIDEFIESC 199


>AF367023-1|AAK53712.1|  250|Homo sapiens KCHIP4.1 protein.
          Length = 250

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 209 VETFFQKMDKNKDGVVTIDEFIESC 233


>AF305072-1|AAG36977.1|  250|Homo sapiens calsenilin-like protein
           protein.
          Length = 250

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 209 VETFFQKMDKNKDGVVTIDEFIESC 233


>AF302044-1|AAG36974.1|  216|Homo sapiens calsenilin-like protein
           protein.
          Length = 216

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 175 VETFFQKMDKNKDGVVTIDEFIESC 199


>AF209502-1|AAL40183.1|  821|Homo sapiens calpain protein.
          Length = 821

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 704 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 743


>AF127765-1|AAD28254.3|  729|Homo sapiens calpain 3 protein.
          Length = 729

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 612 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 651


>AF127764-1|AAD28253.1|  815|Homo sapiens calpain 3 protein.
          Length = 815

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 698 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 737


>AF027977-1|AAC05825.1|  653|Homo sapiens serine/threonine protein
           phosphatase 7 catalytic subunit protein.
          Length = 653

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIK----ETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF  +D D S L++ EEF    K       + ++ S+  +L +  D +  GSI  +EFL
Sbjct: 574 IFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFL 632



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEF 467
           +S+ E +F+  DTD SG IS++EF
Sbjct: 568 RSDLEIIFNAIDTDHSGLISVEEF 591


>AF023455-1|AAB82795.1|  653|Homo sapiens protein phosphatase with
           EF-hands-1 protein.
          Length = 653

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIK----ETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF  +D D S L++ EEF    K       + ++ S+  +L +  D +  GSI  +EFL
Sbjct: 574 IFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFL 632



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEF 467
           +S+ E +F+  DTD SG IS++EF
Sbjct: 568 RSDLEIIFNAIDTDHSGLISVEEF 591


>AC104065-2|AAY40911.1|  107|Homo sapiens unknown protein.
          Length = 107

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDD-IKGC 583
           VE  F+K+DK  DG +TID+ I+ C
Sbjct: 66  VETFFQKMDKNKDGVVTIDEFIESC 90


>AB117940-1|BAD16649.1|  728|Homo sapiens hUp84 protein.
          Length = 728

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEA-EELFSQFDTDSSGSIS 455
           MD DGS  LN +EF +         NK +A +++F  +DTD SG+I+
Sbjct: 611 MDTDGSGKLNLQEFHH-------LWNKIKAWQKIFKHYDTDQSGTIN 650


>U67280-1|AAB97725.1|  315|Homo sapiens calumenin protein.
          Length = 315

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKS-EAEELFSQFDTDSSGSISLDEFL 470
           R F+  D DG  +  KEEF   +     +  K    +E     D ++ G I L+E++
Sbjct: 158 RRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGLIDLEEYI 214


>CR541835-1|CAG46634.1|  315|Homo sapiens CALU protein.
          Length = 315

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKS-EAEELFSQFDTDSSGSISLDEFL 470
           R F+  D DG  +  KEEF   +     +  K    +E     D ++ G I L+E++
Sbjct: 158 RRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYI 214


>CR457039-1|CAG33320.1|  315|Homo sapiens CALU protein.
          Length = 315

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKS-EAEELFSQFDTDSSGSISLDEFL 470
           R F+  D DG  +  KEEF   +     +  K    +E     D ++ G I L+E++
Sbjct: 158 RRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYI 214


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,900,369
Number of Sequences: 237096
Number of extensions: 1536895
Number of successful extensions: 4855
Number of sequences better than 10.0: 259
Number of HSP's better than 10.0 without gapping: 4329
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4795
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6324506272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).