BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0005 (804 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC026072-1|AAH26072.1| 370|Homo sapiens ubiquitin specific pept... 149 2e-35 AL355473-1|CAI16331.1| 370|Homo sapiens ubiquitin specific prot... 149 2e-35 AL158062-1|CAH70555.1| 370|Homo sapiens ubiquitin specific prot... 149 2e-35 AF022789-1|AAC23551.1| 355|Homo sapiens ubiquitin hydrolyzing e... 149 2e-35 BC037574-1|AAH37574.1| 366|Homo sapiens ubiquitin specific pept... 148 3e-35 AK024318-1|BAB14881.1| 366|Homo sapiens protein ( Homo sapiens ... 148 3e-35 AK022614-1|BAB14133.1| 366|Homo sapiens protein ( Homo sapiens ... 148 3e-35 AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific prot... 48 4e-05 AB037793-1|BAA92610.1| 773|Homo sapiens KIAA1372 protein protein. 48 4e-05 BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific pept... 47 9e-05 BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein. 47 9e-05 AK057992-1|BAB71627.1| 706|Homo sapiens protein ( Homo sapiens ... 47 9e-05 AB067478-1|BAB67784.1| 780|Homo sapiens KIAA1891 protein protein. 47 9e-05 BC050525-1|AAH50525.1| 785|Homo sapiens ubiquitin specific pept... 46 2e-04 BC032364-1|AAH32364.1| 222|Homo sapiens USP1 protein protein. 46 2e-04 BC018745-1|AAH18745.1| 223|Homo sapiens Unknown (protein for IM... 46 2e-04 AF117386-1|AAD11441.1| 785|Homo sapiens ubiquitin-specific prot... 46 2e-04 AB014458-1|BAA34703.1| 785|Homo sapiens ubiquitin specific prot... 46 2e-04 Z72499-1|CAA96580.1| 1102|Homo sapiens herpesvirus associated ub... 45 3e-04 AY376241-1|AAQ82908.1| 1112|Homo sapiens ubiquitin-specific prot... 45 3e-04 BT007269-1|AAP35933.1| 520|Homo sapiens ubiquitin specific prot... 40 0.014 BC107138-1|AAI07139.1| 520|Homo sapiens ubiquitin specific pept... 40 0.014 BC107137-1|AAI07138.1| 520|Homo sapiens ubiquitin specific pept... 40 0.014 BC100029-1|AAI00030.1| 393|Homo sapiens USP3 protein protein. 40 0.014 BC065300-1|AAH65300.1| 520|Homo sapiens ubiquitin specific pept... 40 0.014 BC018113-1|AAH18113.1| 520|Homo sapiens ubiquitin specific pept... 40 0.014 AY461579-1|AAT37507.1| 498|Homo sapiens UBP protein protein. 40 0.014 BC016663-1|AAH16663.1| 828|Homo sapiens ubiquitin specific pept... 39 0.024 AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens ... 39 0.024 AK022864-1|BAB14279.1| 828|Homo sapiens protein ( Homo sapiens ... 39 0.024 BC004868-1|AAH04868.1| 508|Homo sapiens ubiquitin specific pept... 38 0.032 AK027820-1|BAB55392.1| 486|Homo sapiens protein ( Homo sapiens ... 38 0.032 AJ586136-1|CAE51936.1| 517|Homo sapiens ubiquitin-specific prot... 38 0.032 AF383173-1|AAL78315.1| 911|Homo sapiens pVHL-interacting deubiq... 38 0.032 AF383172-1|AAL78314.1| 942|Homo sapiens pVHL-interacting deubiq... 38 0.032 AB029020-1|BAA83049.1| 980|Homo sapiens KIAA1097 protein protein. 38 0.032 BC039593-1|AAH39593.1| 913|Homo sapiens ubiquitin specific pept... 38 0.042 AY074877-1|AAL79676.1| 913|Homo sapiens pVHL-interacting deubiq... 38 0.042 AL158207-6|CAC88170.1| 914|Homo sapiens ubiquitin specific pept... 38 0.042 AB023220-1|BAA76847.2| 917|Homo sapiens KIAA1003 protein protein. 38 0.042 Z81365-3|CAI43184.1| 913|Homo sapiens ubiquitin specific peptid... 38 0.056 BC101191-1|AAI01192.1| 913|Homo sapiens ubiquitin specific pept... 38 0.056 BC101190-1|AAI01191.1| 913|Homo sapiens ubiquitin specific pept... 38 0.056 BC101189-1|AAI01190.1| 913|Homo sapiens ubiquitin specific pept... 38 0.056 BC069073-1|AAH69073.1| 913|Homo sapiens ubiquitin specific pept... 38 0.056 BC014176-1|AAH14176.1| 640|Homo sapiens ubiquitin specific pept... 38 0.056 AL365205-13|CAI13188.1| 640|Homo sapiens ubiquitin specific pep... 38 0.056 AL365205-12|CAI13186.1| 585|Homo sapiens ubiquitin specific pep... 38 0.056 AL365205-11|CAI13187.1| 688|Homo sapiens ubiquitin specific pep... 38 0.056 AJ586139-1|CAE51939.1| 688|Homo sapiens ubiquitin-specific prot... 38 0.056 AF285593-1|AAK31972.1| 913|Homo sapiens ubiquitin specific prot... 38 0.056 BC075792-1|AAH75792.1| 1055|Homo sapiens ubiquitin specific pept... 37 0.074 BC015930-1|AAH15930.1| 450|Homo sapiens USP25 protein protein. 37 0.074 AF170562-1|AAF32263.1| 1087|Homo sapiens ubiquitin-specific proc... 37 0.074 AF134213-1|AAF24998.1| 1055|Homo sapiens ubiquitin-specific prot... 37 0.074 X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein. 37 0.098 X63546-1|CAA45108.1| 786|Homo sapiens oncogene protein. 37 0.098 AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific prot... 37 0.098 BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific pept... 36 0.13 BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein. 36 0.13 BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein. 36 0.13 BC106029-1|AAI06030.1| 799|Homo sapiens USP19 protein protein. 36 0.13 BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein. 36 0.13 AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific prot... 36 0.13 AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein. 36 0.13 BC090946-1|AAH90946.1| 565|Homo sapiens ubiquitin specific pept... 36 0.17 BC003130-1|AAH03130.2| 477|Homo sapiens USP21 protein protein. 36 0.17 AL590714-3|CAH72142.1| 551|Homo sapiens ubiquitin specific pept... 36 0.17 AL590714-2|CAH72143.1| 565|Homo sapiens ubiquitin specific pept... 36 0.17 AL157417-1|CAB75649.1| 268|Homo sapiens hypothetical protein pr... 36 0.17 AF233442-1|AAF61308.1| 381|Homo sapiens NEDD8-specific protease... 36 0.17 AF177758-1|AAD54321.1| 565|Homo sapiens ubiquitin specific prot... 36 0.17 AB208899-1|BAD92136.1| 410|Homo sapiens ubiquitin-specific prot... 36 0.17 X91349-1|CAA62690.1| 858|Homo sapiens de-ubiquitinase protein. 36 0.23 U47927-1|AAC50465.1| 858|Homo sapiens isopeptidase T protein. 36 0.23 U47924-8|AAB51314.1| 835|Homo sapiens isopeptidase T protein. 36 0.23 U47924-7|AAB51315.1| 858|Homo sapiens isopeptidase T protein. 36 0.23 U35116-1|AAA78934.1| 835|Homo sapiens ubiquitin isopeptidase T ... 36 0.23 BC005139-1|AAH05139.1| 858|Homo sapiens USP5 protein protein. 36 0.23 BC004889-1|AAH04889.1| 835|Homo sapiens ubiquitin specific pept... 36 0.23 Y13619-1|CAA73941.1| 2070|Homo sapiens DFFRY protein. 35 0.30 Y13618-1|CAA73940.1| 2555|Homo sapiens DFFRY protein. 35 0.30 BC067300-1|AAH67300.1| 350|Homo sapiens USP40 protein protein. 35 0.30 BC030704-1|AAH30704.1| 712|Homo sapiens ubiquitin specific pept... 35 0.30 AJ583821-1|CAE47748.2| 1247|Homo sapiens ubiquitin specific prot... 35 0.30 AF000986-1|AAC51833.1| 2555|Homo sapiens ubiquitin specific prot... 35 0.30 BC133009-1|AAI33010.1| 979|Homo sapiens ubiquitin specific pept... 35 0.40 BC133007-1|AAI33008.1| 979|Homo sapiens USP37 protein protein. 35 0.40 BC112901-1|AAI12902.1| 885|Homo sapiens USP37 protein protein. 35 0.40 AL832645-1|CAD89955.1| 979|Homo sapiens hypothetical protein pr... 35 0.40 AB046814-1|BAB13420.1| 931|Homo sapiens KIAA1594 protein protein. 35 0.40 X98296-1|CAA66942.1| 2547|Homo sapiens ubiquitin hydrolase protein. 34 0.52 D80012-1|BAA11507.1| 813|Homo sapiens KIAA0190 protein. 34 0.52 BX537402-1|CAD97644.1| 824|Homo sapiens hypothetical protein pr... 34 0.52 BC130398-1|AAI30399.1| 912|Homo sapiens USP29 protein protein. 34 0.52 BC130394-1|AAI30395.1| 912|Homo sapiens USP29 protein protein. 34 0.52 BC041366-1|AAH41366.1| 362|Homo sapiens USP2 protein protein. 34 0.52 BC002955-1|AAH02955.1| 605|Homo sapiens ubiquitin specific pept... 34 0.52 BC002854-1|AAH02854.1| 605|Homo sapiens ubiquitin specific pept... 34 0.52 BC000263-1|AAH00263.1| 798|Homo sapiens ubiquitin specific pept... 34 0.52 AL831918-1|CAD38579.1| 810|Homo sapiens hypothetical protein pr... 34 0.52 AL391259-2|CAD13527.2| 2547|Homo sapiens ubiquitin specific pept... 34 0.52 AL109797-1|CAD18900.2| 2547|Homo sapiens ubiquitin specific pept... 34 0.52 AK057225-1|BAB71388.1| 605|Homo sapiens protein ( Homo sapiens ... 34 0.52 AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific prot... 34 0.52 AF440755-1|AAN65363.1| 396|Homo sapiens ubiquitin specific prot... 34 0.52 AF229438-1|AAG10401.1| 922|Homo sapiens ubiquitin-specific proc... 34 0.52 AF079564-1|AAC28392.1| 353|Homo sapiens ubiquitin-specific prot... 34 0.52 AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein. 34 0.52 BC132862-1|AAI32863.1| 1316|Homo sapiens ubiquitin specific pept... 34 0.69 BC060846-1|AAH60846.2| 1202|Homo sapiens USP42 protein protein. 34 0.69 AY618868-1|AAT67238.1| 1324|Homo sapiens ubiquitin specific prot... 34 0.69 AK022759-1|BAB14232.1| 1198|Homo sapiens protein ( Homo sapiens ... 34 0.69 AJ601395-1|CAE53097.1| 1325|Homo sapiens ubiquitin-specific prot... 34 0.69 U20657-1|AAB72237.1| 963|Homo sapiens ubiquitin protease protein. 33 0.91 BC125131-1|AAI25132.1| 963|Homo sapiens ubiquitin specific pept... 33 0.91 BC125130-1|AAI25131.1| 963|Homo sapiens ubiquitin specific pept... 33 0.91 AK223292-1|BAD97012.1| 963|Homo sapiens ubiquitin specific prot... 33 0.91 AK222725-1|BAD96445.1| 916|Homo sapiens ubiquitin specific prot... 33 0.91 AF017306-1|AAC27356.1| 916|Homo sapiens UnpES protein. 33 0.91 AF017305-1|AAC27355.1| 963|Homo sapiens UnpEL protein. 33 0.91 U75362-1|AAC63405.1| 863|Homo sapiens isopeptidase T-3 protein. 33 1.2 BC125123-1|AAI25124.1| 952|Homo sapiens ubiquitin specific pept... 33 1.2 BC016146-1|AAH16146.1| 863|Homo sapiens ubiquitin specific pept... 33 1.2 AY509884-1|AAR91701.1| 530|Homo sapiens deubiquitinating enzyme... 33 1.2 AF153604-1|AAD41086.1| 981|Homo sapiens ubiquitin-specific prot... 33 1.2 AF106069-1|AAD52099.1| 952|Homo sapiens deubiquitinating enzyme... 33 1.2 AF013990-1|AAG28973.1| 902|Homo sapiens ubiquitin C-terminal hy... 33 1.2 AB011101-1|BAA25455.2| 952|Homo sapiens KIAA0529 protein protein. 33 1.2 D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein. 33 1.6 BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein pr... 33 1.6 BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific pept... 33 1.6 BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein. 33 1.6 BC038983-1|AAH38983.1| 285|Homo sapiens USP36 protein protein. 33 1.6 BC027992-1|AAH27992.1| 959|Homo sapiens USP36 protein protein. 33 1.6 BC016487-1|AAH16487.1| 963|Homo sapiens Unknown (protein for IM... 33 1.6 AY169386-1|AAO34133.1| 548|Homo sapiens deubiquitinating enzyme... 33 1.6 AK022913-1|BAB14306.1| 548|Homo sapiens protein ( Homo sapiens ... 33 1.6 AK001671-1|BAA91825.1| 954|Homo sapiens protein ( Homo sapiens ... 33 1.6 AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein. 33 1.6 U30888-1|AAB60365.1| 494|Homo sapiens tRNA-Guanine Transglycosy... 32 2.1 BX640815-1|CAE45893.1| 453|Homo sapiens hypothetical protein pr... 32 2.1 BX538024-1|CAD97970.1| 979|Homo sapiens hypothetical protein pr... 32 2.1 BT007183-1|AAP35847.1| 494|Homo sapiens ubiquitin specific prot... 32 2.1 BC126898-1|AAI26899.1| 513|Homo sapiens USP22 protein protein. 32 2.1 BC110499-1|AAI10500.1| 512|Homo sapiens USP22 protein protein. 32 2.1 BC003556-1|AAH03556.1| 494|Homo sapiens ubiquitin specific pept... 32 2.1 AY533200-1|AAS59847.1| 398|Homo sapiens deubiquitinating enzyme... 32 2.1 AY188990-1|AAO38845.1| 530|Homo sapiens deubiquitinating enzyme... 32 2.1 AF544012-1|AAQ11742.1| 530|Homo sapiens deubiquitinating enzyme... 32 2.1 AF544011-1|AAQ11741.1| 530|Homo sapiens deubiquitinating enzyme... 32 2.1 AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific prot... 32 2.1 AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific prot... 32 2.1 AF155116-1|AAD42882.1| 828|Homo sapiens NY-REN-60 antigen protein. 32 2.1 AB028986-1|BAA83015.1| 593|Homo sapiens KIAA1063 protein protein. 32 2.1 AF073344-1|AAD42992.1| 521|Homo sapiens ubiquitin-specific prot... 32 2.8 U44839-1|AAC50450.1| 690|Homo sapiens UHX1 protein protein. 31 4.9 BC063668-1|AAH63668.1| 923|Homo sapiens USP11 protein protein. 31 4.9 BC030777-1|AAH30777.1| 822|Homo sapiens ubiquitin specific pept... 31 4.9 BC000350-1|AAH00350.4| 921|Homo sapiens USP11 protein protein. 31 4.9 AY333928-1|AAR13293.1| 408|Homo sapiens USP16 protein. 31 4.9 AL163249-3|CAB90432.1| 823|Homo sapiens human ubiquitin process... 31 4.9 AL096791-3|CAD20056.1| 690|Homo sapiens ubiquitin specific pept... 31 4.9 AL096791-2|CAI42996.1| 140|Homo sapiens ubiquitin specific pept... 31 4.9 AK222884-1|BAD96604.1| 823|Homo sapiens ubiquitin specific prot... 31 4.9 AK222681-1|BAD96401.1| 823|Homo sapiens ubiquitin specific prot... 31 4.9 AF126736-1|AAD20949.1| 823|Homo sapiens ubiquitin processing pr... 31 4.9 AB073597-1|BAC20463.1| 921|Homo sapiens deubiquitinating enzyme... 31 4.9 AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens ... 30 8.5 AB028980-1|BAA83009.1| 977|Homo sapiens KIAA1057 protein protein. 30 8.5 >BC026072-1|AAH26072.1| 370|Homo sapiens ubiquitin specific peptidase 12 protein. Length = 370 Score = 149 bits (360), Expect = 2e-35 Identities = 71/87 (81%), Positives = 75/87 (86%) Frame = +1 Query: 247 PTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 426 P EHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 33 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 91 Query: 427 ATQKKKVGSIAPKKFIARLRKEKEEFD 507 ATQKKKVG I PKKFI RLRKE E FD Sbjct: 92 ATQKKKVGVIPPKKFITRLRKENELFD 118 Score = 80.2 bits (189), Expect = 8e-15 Identities = 40/73 (54%), Positives = 49/73 (67%) Frame = +3 Query: 507 HYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 +YMQQDAHEFLN+L+N I +I+ ER Q + N + N S P +PTWV EI Sbjct: 119 NYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTP---DPTWVDEI 175 Query: 687 FQGTLTSETRCLT 725 FQGTLT+ETRCLT Sbjct: 176 FQGTLTNETRCLT 188 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 197 MGANISQLERDIGSEQFP 250 MGAN S LE++IG EQFP Sbjct: 16 MGANASALEKEIGPEQFP 33 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 754 FL*LQVDVGQNTSITHC 804 FL L VDV QNTSITHC Sbjct: 199 FLDLSVDVEQNTSITHC 215 >AL355473-1|CAI16331.1| 370|Homo sapiens ubiquitin specific protease 12 like 1 protein. Length = 370 Score = 149 bits (360), Expect = 2e-35 Identities = 71/87 (81%), Positives = 75/87 (86%) Frame = +1 Query: 247 PTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 426 P EHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 33 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 91 Query: 427 ATQKKKVGSIAPKKFIARLRKEKEEFD 507 ATQKKKVG I PKKFI RLRKE E FD Sbjct: 92 ATQKKKVGVIPPKKFITRLRKENELFD 118 Score = 83.8 bits (198), Expect = 7e-16 Identities = 41/73 (56%), Positives = 50/73 (68%) Frame = +3 Query: 507 HYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 +YMQQDAHEFLN+L+N I +I+ ER Q + N + N S P +PTWVHEI Sbjct: 119 NYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTP---DPTWVHEI 175 Query: 687 FQGTLTSETRCLT 725 FQGTLT+ETRCLT Sbjct: 176 FQGTLTNETRCLT 188 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 197 MGANISQLERDIGSEQFP 250 MGAN S LE++IG EQFP Sbjct: 16 MGANASALEKEIGPEQFP 33 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 754 FL*LQVDVGQNTSITHC 804 FL L VDV QNTSITHC Sbjct: 199 FLDLSVDVEQNTSITHC 215 >AL158062-1|CAH70555.1| 370|Homo sapiens ubiquitin specific protease 12 like 1 protein. Length = 370 Score = 149 bits (360), Expect = 2e-35 Identities = 71/87 (81%), Positives = 75/87 (86%) Frame = +1 Query: 247 PTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 426 P EHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 33 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 91 Query: 427 ATQKKKVGSIAPKKFIARLRKEKEEFD 507 ATQKKKVG I PKKFI RLRKE E FD Sbjct: 92 ATQKKKVGVIPPKKFITRLRKENELFD 118 Score = 83.8 bits (198), Expect = 7e-16 Identities = 41/73 (56%), Positives = 50/73 (68%) Frame = +3 Query: 507 HYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 +YMQQDAHEFLN+L+N I +I+ ER Q + N + N S P +PTWVHEI Sbjct: 119 NYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTP---DPTWVHEI 175 Query: 687 FQGTLTSETRCLT 725 FQGTLT+ETRCLT Sbjct: 176 FQGTLTNETRCLT 188 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 197 MGANISQLERDIGSEQFP 250 MGAN S LE++IG EQFP Sbjct: 16 MGANASALEKEIGPEQFP 33 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 754 FL*LQVDVGQNTSITHC 804 FL L VDV QNTSITHC Sbjct: 199 FLDLSVDVEQNTSITHC 215 >AF022789-1|AAC23551.1| 355|Homo sapiens ubiquitin hydrolyzing enzyme I protein. Length = 355 Score = 149 bits (360), Expect = 2e-35 Identities = 71/87 (81%), Positives = 75/87 (86%) Frame = +1 Query: 247 PTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 426 P EHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 18 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 76 Query: 427 ATQKKKVGSIAPKKFIARLRKEKEEFD 507 ATQKKKVG I PKKFI RLRKE E FD Sbjct: 77 ATQKKKVGVIPPKKFITRLRKENELFD 103 Score = 83.8 bits (198), Expect = 7e-16 Identities = 41/73 (56%), Positives = 50/73 (68%) Frame = +3 Query: 507 HYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 +YMQQDAHEFLN+L+N I +I+ ER Q + N + N S P +PTWVHEI Sbjct: 104 NYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTP---DPTWVHEI 160 Query: 687 FQGTLTSETRCLT 725 FQGTLT+ETRCLT Sbjct: 161 FQGTLTNETRCLT 173 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 197 MGANISQLERDIGSEQFP 250 MGAN S LE++IG EQFP Sbjct: 1 MGANASALEKEIGPEQFP 18 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 754 FL*LQVDVGQNTSITHC 804 FL L VDV QNTSITHC Sbjct: 184 FLDLSVDVEQNTSITHC 200 >BC037574-1|AAH37574.1| 366|Homo sapiens ubiquitin specific peptidase 46 protein. Length = 366 Score = 148 bits (358), Expect = 3e-35 Identities = 70/87 (80%), Positives = 75/87 (86%) Frame = +1 Query: 247 PTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 426 P EHYFGLVNFGNTCY NSVLQALYFCRPFRE VL YKA+ K+ KE LLTCLADLF+SI Sbjct: 29 PINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKK-KENLLTCLADLFHSI 87 Query: 427 ATQKKKVGSIAPKKFIARLRKEKEEFD 507 ATQKKKVG I PKKFI+RLRKE + FD Sbjct: 88 ATQKKKVGVIPPKKFISRLRKENDLFD 114 Score = 78.2 bits (184), Expect = 3e-14 Identities = 38/72 (52%), Positives = 47/72 (65%) Frame = +3 Query: 507 HYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 +YMQQDAHEFLN+L+N I +I+ E+ Q + N N + P E TWVHEI Sbjct: 115 NYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKP---ELTWVHEI 171 Query: 687 FQGTLTSETRCL 722 FQGTLT+ETRCL Sbjct: 172 FQGTLTNETRCL 183 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 197 MGANISQLERDIGSEQFP 250 MG N S LE+DIG EQFP Sbjct: 12 MGTNASALEKDIGPEQFP 29 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 754 FL*LQVDVGQNTSITHC 804 FL L VDV QNTSITHC Sbjct: 195 FLDLSVDVEQNTSITHC 211 >AK024318-1|BAB14881.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ14256 fis, clone PLACE1000007, weakly similar to PROBABLE UBIQUITIN CARBOXYL-TERMINAL HYDROLASE R10E11.3 (EC ). Length = 366 Score = 148 bits (358), Expect = 3e-35 Identities = 70/87 (80%), Positives = 75/87 (86%) Frame = +1 Query: 247 PTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 426 P EHYFGLVNFGNTCY NSVLQALYFCRPFRE VL YKA+ K+ KE LLTCLADLF+SI Sbjct: 29 PINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKK-KENLLTCLADLFHSI 87 Query: 427 ATQKKKVGSIAPKKFIARLRKEKEEFD 507 ATQKKKVG I PKKFI+RLRKE + FD Sbjct: 88 ATQKKKVGVIPPKKFISRLRKENDLFD 114 Score = 78.2 bits (184), Expect = 3e-14 Identities = 38/72 (52%), Positives = 47/72 (65%) Frame = +3 Query: 507 HYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 +YMQQDAHEFLN+L+N I +I+ E+ Q + N N + P E TWVHEI Sbjct: 115 NYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKP---ELTWVHEI 171 Query: 687 FQGTLTSETRCL 722 FQGTLT+ETRCL Sbjct: 172 FQGTLTNETRCL 183 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 197 MGANISQLERDIGSEQFP 250 MG N S LE+DIG EQFP Sbjct: 12 MGTNASALEKDIGPEQFP 29 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 754 FL*LQVDVGQNTSITHC 804 FL L VDV QNTSITHC Sbjct: 195 FLDLSVDVEQNTSITHC 211 >AK022614-1|BAB14133.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ12552 fis, clone NT2RM4000712, moderately similar to Homo sapiens ubiquitin hydrolyzing enzyme I (UBH1) mRNA. ). Length = 366 Score = 148 bits (358), Expect = 3e-35 Identities = 70/87 (80%), Positives = 75/87 (86%) Frame = +1 Query: 247 PTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 426 P EHYFGLVNFGNTCY NSVLQALYFCRPFRE VL YKA+ K+ KE LLTCLADLF+SI Sbjct: 29 PINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKK-KENLLTCLADLFHSI 87 Query: 427 ATQKKKVGSIAPKKFIARLRKEKEEFD 507 ATQKKKVG I PKKFI+RLRKE + FD Sbjct: 88 ATQKKKVGVIPPKKFISRLRKENDLFD 114 Score = 78.2 bits (184), Expect = 3e-14 Identities = 38/72 (52%), Positives = 47/72 (65%) Frame = +3 Query: 507 HYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 +YMQQDAHEFLN+L+N I +I+ E+ Q + N N + P E TWVHEI Sbjct: 115 NYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKP---ELTWVHEI 171 Query: 687 FQGTLTSETRCL 722 FQGTLT+ETRCL Sbjct: 172 FQGTLTNETRCL 183 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 197 MGANISQLERDIGSEQFP 250 MG N S LE+DIG EQFP Sbjct: 12 MGTNASALEKDIGPEQFP 29 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 754 FL*LQVDVGQNTSITHC 804 FL L VDV QNTSITHC Sbjct: 195 FLDLSVDVEQNTSITHC 211 >AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific proteinase 35 protein. Length = 1017 Score = 48.0 bits (109), Expect = 4e-05 Identities = 27/70 (38%), Positives = 40/70 (57%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL+N GNTCY NS+LQAL+ FR VL N + L+T L LF + ++ Sbjct: 441 GLINLGNTCYVNSILQALFMASEFRHCVLRLTENN---SQPLMTKLQWLFGFLEHSQRP- 496 Query: 448 GSIAPKKFIA 477 +I+P+ F++ Sbjct: 497 -AISPENFLS 505 >AB037793-1|BAA92610.1| 773|Homo sapiens KIAA1372 protein protein. Length = 773 Score = 48.0 bits (109), Expect = 4e-05 Identities = 27/70 (38%), Positives = 40/70 (57%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL+N GNTCY NS+LQAL+ FR VL N + L+T L LF + ++ Sbjct: 197 GLINLGNTCYVNSILQALFMASDFRHCVLRLTENN---SQPLMTKLQWLFGFLEHSQRP- 252 Query: 448 GSIAPKKFIA 477 +I+P+ F++ Sbjct: 253 -AISPENFLS 261 >BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific peptidase 38 protein. Length = 1042 Score = 46.8 bits (106), Expect = 9e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 446 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 501 Query: 448 GSIAPKKFIARLR 486 + AP+ F R Sbjct: 502 -AYAPRIFFEASR 513 Score = 31.5 bits (68), Expect = 3.7 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 11/89 (12%) Frame = +3 Query: 516 QQDAHEFLNFLINHINE-----IILAERNQSTLKVQKNNSGENVTCNGSVPHNT------ 662 QQD E+L FL++ ++E + A S + S + V +V T Sbjct: 522 QQDCSEYLRFLLDRLHEEEKILKVQASHKPSEILECSETSLQEVASKAAVLTETPRTSDG 581 Query: 663 EPTWVHEIFQGTLTSETRCLTVRRSAVKM 749 E T + ++F G L + RCL R ++ K+ Sbjct: 582 EKTLIEKMFGGKLRTHIRCLNCRSTSQKV 610 >BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein. Length = 1004 Score = 46.8 bits (106), Expect = 9e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 446 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 501 Query: 448 GSIAPKKFIARLR 486 + AP+ F R Sbjct: 502 -AYAPRIFFEASR 513 Score = 31.5 bits (68), Expect = 3.7 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 11/89 (12%) Frame = +3 Query: 516 QQDAHEFLNFLINHINE-----IILAERNQSTLKVQKNNSGENVTCNGSVPHNT------ 662 QQD E+L FL++ ++E + A S + S + V +V T Sbjct: 522 QQDCSEYLRFLLDRLHEEEKILKVQASHKPSEILECSETSLQEVASKAAVLTETPRTSDG 581 Query: 663 EPTWVHEIFQGTLTSETRCLTVRRSAVKM 749 E T + ++F G L + RCL R ++ K+ Sbjct: 582 EKTLIEKMFGGKLRTHIRCLNCRSTSQKV 610 >AK057992-1|BAB71627.1| 706|Homo sapiens protein ( Homo sapiens cDNA FLJ25263 fis, clone STM05053. ). Length = 706 Score = 46.8 bits (106), Expect = 9e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 110 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 165 Query: 448 GSIAPKKFIARLR 486 + AP+ F R Sbjct: 166 -AYAPRIFFEASR 177 Score = 31.5 bits (68), Expect = 3.7 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 11/89 (12%) Frame = +3 Query: 516 QQDAHEFLNFLINHINE-----IILAERNQSTLKVQKNNSGENVTCNGSVPHNT------ 662 QQD E+L FL++ ++E + A S + S + V +V T Sbjct: 186 QQDCSEYLRFLLDRLHEEEKILKVQASHKPSEILECSETSLQEVASKAAVLTETPRTSDG 245 Query: 663 EPTWVHEIFQGTLTSETRCLTVRRSAVKM 749 E T + ++F G L + RCL R ++ K+ Sbjct: 246 EKTLIEKMFGGKLRTHIRCLNCRSTSQKV 274 >AB067478-1|BAB67784.1| 780|Homo sapiens KIAA1891 protein protein. Length = 780 Score = 46.8 bits (106), Expect = 9e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 184 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 239 Query: 448 GSIAPKKFIARLR 486 + AP+ F R Sbjct: 240 -AYAPRIFFEASR 251 Score = 31.5 bits (68), Expect = 3.7 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 11/89 (12%) Frame = +3 Query: 516 QQDAHEFLNFLINHINE-----IILAERNQSTLKVQKNNSGENVTCNGSVPHNT------ 662 QQD E+L FL++ ++E + A S + S + V +V T Sbjct: 260 QQDCSEYLRFLLDRLHEEEKILKVQASHKPSEILECSETSLQEVASKAAVLTETPRTSDG 319 Query: 663 EPTWVHEIFQGTLTSETRCLTVRRSAVKM 749 E T + ++F G L + RCL R ++ K+ Sbjct: 320 EKTLIEKMFGGKLRTHIRCLNCRSTSQKV 348 >BC050525-1|AAH50525.1| 785|Homo sapiens ubiquitin specific peptidase 1 protein. Length = 785 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 393 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >BC032364-1|AAH32364.1| 222|Homo sapiens USP1 protein protein. Length = 222 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 393 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >BC018745-1|AAH18745.1| 223|Homo sapiens Unknown (protein for IMAGE:4649027) protein. Length = 223 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 393 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >AF117386-1|AAD11441.1| 785|Homo sapiens ubiquitin-specific protease protein. Length = 785 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 393 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >AB014458-1|BAA34703.1| 785|Homo sapiens ubiquitin specific protease protein. Length = 785 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 393 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >Z72499-1|CAA96580.1| 1102|Homo sapiens herpesvirus associated ubiquitin-specific protease (HAUSP) protein. Length = 1102 Score = 45.2 bits (102), Expect = 3e-04 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 441 Y GL N G TCY NS+LQ L+F R+ V + + +++ L +FY + K Sbjct: 213 YVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDK 272 Query: 442 KVGS 453 VG+ Sbjct: 273 PVGT 276 >AY376241-1|AAQ82908.1| 1112|Homo sapiens ubiquitin-specific protease 7 isoform protein. Length = 1112 Score = 45.2 bits (102), Expect = 3e-04 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 441 Y GL N G TCY NS+LQ L+F R+ V + + +++ L +FY + K Sbjct: 223 YVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDK 282 Query: 442 KVGS 453 VG+ Sbjct: 283 PVGT 286 >BT007269-1|AAP35933.1| 520|Homo sapiens ubiquitin specific protease 3 protein. Length = 520 Score = 39.5 bits (88), Expect = 0.014 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHIN-EIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 Y QQDAHEF+ +L++H++ E+ S + + NS ++ + N T V I Sbjct: 256 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENS--TLSASNKCCINGASTVVTAI 313 Query: 687 FQGTLTSETRCL 722 F G L +E CL Sbjct: 314 FGGILQNEVNCL 325 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >BC107138-1|AAI07139.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 39.5 bits (88), Expect = 0.014 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHIN-EIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 Y QQDAHEF+ +L++H++ E+ S + + NS ++ + N T V I Sbjct: 256 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENS--TLSASNKCCINGASTVVTAI 313 Query: 687 FQGTLTSETRCL 722 F G L +E CL Sbjct: 314 FGGILQNEVNCL 325 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >BC107137-1|AAI07138.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 39.5 bits (88), Expect = 0.014 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHIN-EIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 Y QQDAHEF+ +L++H++ E+ S + + NS ++ + N T V I Sbjct: 256 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENS--TLSASNKCCINGASTVVTAI 313 Query: 687 FQGTLTSETRCL 722 F G L +E CL Sbjct: 314 FGGILQNEVNCL 325 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >BC100029-1|AAI00030.1| 393|Homo sapiens USP3 protein protein. Length = 393 Score = 39.5 bits (88), Expect = 0.014 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHIN-EIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 Y QQDAHEF+ +L++H++ E+ S + + NS ++ + N T V I Sbjct: 256 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENS--TLSASNKCCINGASTVVTAI 313 Query: 687 FQGTLTSETRCL 722 F G L +E CL Sbjct: 314 FGGILQNEVNCL 325 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >BC065300-1|AAH65300.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 39.5 bits (88), Expect = 0.014 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHIN-EIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 Y QQDAHEF+ +L++H++ E+ S + + NS ++ + N T V I Sbjct: 256 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENS--TLSASNKCCINGASTVVTAI 313 Query: 687 FQGTLTSETRCL 722 F G L +E CL Sbjct: 314 FGGILQNEVNCL 325 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >BC018113-1|AAH18113.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 39.5 bits (88), Expect = 0.014 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHIN-EIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 Y QQDAHEF+ +L++H++ E+ S + + NS ++ + N T V I Sbjct: 256 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENS--TLSASNKCCINGASTVVTAI 313 Query: 687 FQGTLTSETRCL 722 F G L +E CL Sbjct: 314 FGGILQNEVNCL 325 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >AY461579-1|AAT37507.1| 498|Homo sapiens UBP protein protein. Length = 498 Score = 39.5 bits (88), Expect = 0.014 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHIN-EIILAERNQSTLKVQKNNSGENVTCNGSVPHNTEPTWVHEI 686 Y QQDAHEF+ +L++H++ E+ S + + NS ++ + N T V I Sbjct: 234 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENS--TLSASNKCCINGASTVVTAI 291 Query: 687 FQGTLTSETRCL 722 F G L +E CL Sbjct: 292 FGGILQNEVNCL 303 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 138 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 167 >BC016663-1|AAH16663.1| 828|Homo sapiens ubiquitin specific peptidase 33 protein. Length = 828 Score = 38.7 bits (86), Expect = 0.024 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 444 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 186 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWHKSR 244 Query: 445 VGSIAP 462 GS+ P Sbjct: 245 PGSVVP 250 >AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens cDNA FLJ14456 fis, clone HEMBB1001915, moderately similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 64E (EC 3.1.2.15). ). Length = 1287 Score = 38.7 bits (86), Expect = 0.024 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTC----LADLFYSIA 429 Y GLVN TCY NS+LQ L+ FR + YK + + ++E +T L LF + Sbjct: 99 YVGLVNQAMTCYLNSLLQTLFMTPEFRNAL--YKWEFEESEEDPVTSIPYQLQRLFVLLQ 156 Query: 430 TQKKK 444 T KK+ Sbjct: 157 TSKKR 161 >AK022864-1|BAB14279.1| 828|Homo sapiens protein ( Homo sapiens cDNA FLJ12802 fis, clone NT2RP2002124, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15). ). Length = 828 Score = 38.7 bits (86), Expect = 0.024 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 444 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 186 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWHKSR 244 Query: 445 VGSIAP 462 GS+ P Sbjct: 245 PGSVVP 250 >BC004868-1|AAH04868.1| 508|Homo sapiens ubiquitin specific peptidase 30 protein. Length = 508 Score = 38.3 bits (85), Expect = 0.032 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKE 387 GLVN GNTC+ NS+LQ L C F + E+ ++ R ++ Sbjct: 60 GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQK 99 >AK027820-1|BAB55392.1| 486|Homo sapiens protein ( Homo sapiens cDNA FLJ14914 fis, clone PLACE1006829, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15). ). Length = 486 Score = 38.3 bits (85), Expect = 0.032 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKE 387 GLVN GNTC+ NS+LQ L C F + E+ ++ R ++ Sbjct: 38 GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQK 77 >AJ586136-1|CAE51936.1| 517|Homo sapiens ubiquitin-specific proteinase 30 protein. Length = 517 Score = 38.3 bits (85), Expect = 0.032 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKE 387 GLVN GNTC+ NS+LQ L C F + E+ ++ R ++ Sbjct: 69 GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQK 108 >AF383173-1|AAL78315.1| 911|Homo sapiens pVHL-interacting deubiquitinating enzyme 1 type II protein. Length = 911 Score = 38.3 bits (85), Expect = 0.032 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 444 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 155 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWYKSR 213 Query: 445 VGSIAP 462 GS+ P Sbjct: 214 PGSVVP 219 >AF383172-1|AAL78314.1| 942|Homo sapiens pVHL-interacting deubiquitinating enzyme 1 type I protein. Length = 942 Score = 38.3 bits (85), Expect = 0.032 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 444 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 186 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWYKSR 244 Query: 445 VGSIAP 462 GS+ P Sbjct: 245 PGSVVP 250 >AB029020-1|BAA83049.1| 980|Homo sapiens KIAA1097 protein protein. Length = 980 Score = 38.3 bits (85), Expect = 0.032 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 444 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 224 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWYKSR 282 Query: 445 VGSIAP 462 GS+ P Sbjct: 283 PGSVVP 288 >BC039593-1|AAH39593.1| 913|Homo sapiens ubiquitin specific peptidase 20 protein. Length = 913 Score = 37.9 bits (84), Expect = 0.042 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 146 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 205 Query: 448 GSIAP 462 + P Sbjct: 206 SYVVP 210 >AY074877-1|AAL79676.1| 913|Homo sapiens pVHL-interacting deubiquitinating enzyme 2 protein. Length = 913 Score = 37.9 bits (84), Expect = 0.042 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 146 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 205 Query: 448 GSIAP 462 + P Sbjct: 206 SYVVP 210 >AL158207-6|CAC88170.1| 914|Homo sapiens ubiquitin specific peptidase 20 protein. Length = 914 Score = 37.9 bits (84), Expect = 0.042 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 146 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 205 Query: 448 GSIAP 462 + P Sbjct: 206 SYVVP 210 >AB023220-1|BAA76847.2| 917|Homo sapiens KIAA1003 protein protein. Length = 917 Score = 37.9 bits (84), Expect = 0.042 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 150 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 209 Query: 448 GSIAP 462 + P Sbjct: 210 SYVVP 214 >Z81365-3|CAI43184.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 37.5 bits (83), Expect = 0.056 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 420 GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 296 GLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC101191-1|AAI01192.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 37.5 bits (83), Expect = 0.056 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 420 GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 296 GLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC101190-1|AAI01191.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 37.5 bits (83), Expect = 0.056 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 420 GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 296 GLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC101189-1|AAI01190.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 37.5 bits (83), Expect = 0.056 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 420 GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 296 GLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC069073-1|AAH69073.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 37.5 bits (83), Expect = 0.056 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 420 GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 296 GLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC014176-1|AAH14176.1| 640|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 640 Score = 37.5 bits (83), Expect = 0.056 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFRE 345 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AL365205-13|CAI13188.1| 640|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 640 Score = 37.5 bits (83), Expect = 0.056 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFRE 345 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AL365205-12|CAI13186.1| 585|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 585 Score = 37.5 bits (83), Expect = 0.056 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFRE 345 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AL365205-11|CAI13187.1| 688|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 688 Score = 37.5 bits (83), Expect = 0.056 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFRE 345 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AJ586139-1|CAE51939.1| 688|Homo sapiens ubiquitin-specific proteinase 49 protein. Length = 688 Score = 37.5 bits (83), Expect = 0.056 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFRE 345 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AF285593-1|AAK31972.1| 913|Homo sapiens ubiquitin specific protease 26 protein. Length = 913 Score = 37.5 bits (83), Expect = 0.056 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 420 GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 296 GLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC075792-1|AAH75792.1| 1055|Homo sapiens ubiquitin specific peptidase 25 protein. Length = 1055 Score = 37.1 bits (82), Expect = 0.074 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >BC015930-1|AAH15930.1| 450|Homo sapiens USP25 protein protein. Length = 450 Score = 37.1 bits (82), Expect = 0.074 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >AF170562-1|AAF32263.1| 1087|Homo sapiens ubiquitin-specific processing protease protein. Length = 1087 Score = 37.1 bits (82), Expect = 0.074 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >AF134213-1|AAF24998.1| 1055|Homo sapiens ubiquitin-specific protease protein. Length = 1055 Score = 37.1 bits (82), Expect = 0.074 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein. Length = 1089 Score = 36.7 bits (81), Expect = 0.098 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 7/95 (7%) Frame = +1 Query: 244 VPTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKRT-----KETLLTC 402 VPT + GL N GNTC+ NS +Q + +P + + + + RT K + C Sbjct: 208 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC 267 Query: 403 LADLFYSIATQKKKVGSIAPKKFIARLRKEKEEFD 507 DL + + +K S+AP K + K +FD Sbjct: 268 YGDLVQELWSGTQK--SVAPLKLRRTIAKYAPKFD 300 >X63546-1|CAA45108.1| 786|Homo sapiens oncogene protein. Length = 786 Score = 36.7 bits (81), Expect = 0.098 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 7/95 (7%) Frame = +1 Query: 244 VPTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKRT-----KETLLTC 402 VPT + GL N GNTC+ NS +Q + +P + + + + RT K + C Sbjct: 525 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC 584 Query: 403 LADLFYSIATQKKKVGSIAPKKFIARLRKEKEEFD 507 DL + + +K S+AP K + K +FD Sbjct: 585 YGDLVQELWSGTQK--SVAPLKLRRTIAKYAPKFD 617 >AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific protease USP6 protein. Length = 1406 Score = 36.7 bits (81), Expect = 0.098 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 7/95 (7%) Frame = +1 Query: 244 VPTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKRT-----KETLLTC 402 VPT + GL N GNTC+ NS +Q + +P + + + + RT K + C Sbjct: 525 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC 584 Query: 403 LADLFYSIATQKKKVGSIAPKKFIARLRKEKEEFD 507 DL + + +K S+AP K + K +FD Sbjct: 585 YGDLVQELWSGTQK--SVAPLKLRRTIAKYAPKFD 617 >BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific peptidase 19 protein. Length = 1318 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 496 FTGLVNLGNTCFMNSVIQSLSNTRELRD 523 >BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein. Length = 1449 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 664 FTGLVNLGNTCFMNSVIQSLSNTRELRD 691 >BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein. Length = 1447 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 662 FTGLVNLGNTCFMNSVIQSLSNTRELRD 689 >BC106029-1|AAI06030.1| 799|Homo sapiens USP19 protein protein. Length = 799 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 642 FTGLVNLGNTCFMNSVIQSLSNTRELRD 669 >BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein. Length = 1179 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 394 FTGLVNLGNTCFMNSVIQSLSNTRELRD 421 >AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific proteinase 51 protein. Length = 711 Score = 36.3 bits (80), Expect = 0.13 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = +1 Query: 205 KYITVGKRYRVRAVPTYEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTK 384 K + K+ R ++V T GL+N GNTC+ N ++QAL ++ L K K T Sbjct: 344 KLVKPKKKRRKKSVYTVG-LRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTS 402 Query: 385 ETL-LTC-LADLFYSI 426 +L L C ++ LF+++ Sbjct: 403 PSLCLVCEMSSLFHAM 418 >AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein. Length = 1371 Score = 36.3 bits (80), Expect = 0.13 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 549 FTGLVNLGNTCFMNSVIQSLSNTRELRD 576 >BC090946-1|AAH90946.1| 565|Homo sapiens ubiquitin specific peptidase 21 protein. Length = 565 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >BC003130-1|AAH03130.2| 477|Homo sapiens USP21 protein protein. Length = 477 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 123 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 150 >AL590714-3|CAH72142.1| 551|Homo sapiens ubiquitin specific peptidase 21 protein. Length = 551 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >AL590714-2|CAH72143.1| 565|Homo sapiens ubiquitin specific peptidase 21 protein. Length = 565 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >AL157417-1|CAB75649.1| 268|Homo sapiens hypothetical protein protein. Length = 268 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 21 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 48 >AF233442-1|AAF61308.1| 381|Homo sapiens NEDD8-specific protease protein. Length = 381 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 27 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 54 >AF177758-1|AAD54321.1| 565|Homo sapiens ubiquitin specific protease 16 protein. Length = 565 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >AB208899-1|BAD92136.1| 410|Homo sapiens ubiquitin-specific protease 21 isoform b variant protein. Length = 410 Score = 35.9 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFRE 345 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 239 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 266 >X91349-1|CAA62690.1| 858|Homo sapiens de-ubiquitinase protein. Length = 858 Score = 35.5 bits (78), Expect = 0.23 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U47927-1|AAC50465.1| 858|Homo sapiens isopeptidase T protein. Length = 858 Score = 35.5 bits (78), Expect = 0.23 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U47924-8|AAB51314.1| 835|Homo sapiens isopeptidase T protein. Length = 835 Score = 35.5 bits (78), Expect = 0.23 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U47924-7|AAB51315.1| 858|Homo sapiens isopeptidase T protein. Length = 858 Score = 35.5 bits (78), Expect = 0.23 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U35116-1|AAA78934.1| 835|Homo sapiens ubiquitin isopeptidase T protein. Length = 835 Score = 35.5 bits (78), Expect = 0.23 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >BC005139-1|AAH05139.1| 858|Homo sapiens USP5 protein protein. Length = 858 Score = 35.5 bits (78), Expect = 0.23 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >BC004889-1|AAH04889.1| 835|Homo sapiens ubiquitin specific peptidase 5 (isopeptidase T) protein. Length = 835 Score = 35.5 bits (78), Expect = 0.23 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >Y13619-1|CAA73941.1| 2070|Homo sapiens DFFRY protein. Length = 2070 Score = 35.1 bits (77), Expect = 0.30 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVL 354 + GL N G TCY NSV+Q LY R +L Sbjct: 1558 FVGLKNAGATCYMNSVIQQLYMIPSIRNSIL 1588 >Y13618-1|CAA73940.1| 2555|Homo sapiens DFFRY protein. Length = 2555 Score = 35.1 bits (77), Expect = 0.30 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVL 354 + GL N G TCY NSV+Q LY R +L Sbjct: 1558 FVGLKNAGATCYMNSVIQQLYMIPSIRNSIL 1588 >BC067300-1|AAH67300.1| 350|Homo sapiens USP40 protein protein. Length = 350 Score = 35.1 bits (77), Expect = 0.30 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFRE 345 G+ N G TCY NS+LQ L+F FRE Sbjct: 74 GIRNQGGTCYLNSLLQTLHFTPEFRE 99 >BC030704-1|AAH30704.1| 712|Homo sapiens ubiquitin specific peptidase 44 protein. Length = 712 Score = 35.1 bits (77), Expect = 0.30 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 GL N GNTCY NSVLQ L FR+ L+ Sbjct: 274 GLRNLGNTCYMNSVLQVLSHLLIFRQCFLK 303 >AJ583821-1|CAE47748.2| 1247|Homo sapiens ubiquitin specific proteinase 40 protein. Length = 1247 Score = 35.1 bits (77), Expect = 0.30 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFRE 345 G+ N G TCY NS+LQ L+F FRE Sbjct: 54 GIRNQGGTCYLNSLLQTLHFTPEFRE 79 >AF000986-1|AAC51833.1| 2555|Homo sapiens ubiquitin specific protease 9 protein. Length = 2555 Score = 35.1 bits (77), Expect = 0.30 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVL 354 + GL N G TCY NSV+Q LY R +L Sbjct: 1558 FVGLKNAGATCYMNSVIQQLYMIPSIRNSIL 1588 >BC133009-1|AAI33010.1| 979|Homo sapiens ubiquitin specific peptidase 37 protein. Length = 979 Score = 34.7 bits (76), Expect = 0.40 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 G N GNTCY N++LQ+L+ + F +L+ Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSFANDLLK 371 >BC133007-1|AAI33008.1| 979|Homo sapiens USP37 protein protein. Length = 979 Score = 34.7 bits (76), Expect = 0.40 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 G N GNTCY N++LQ+L+ + F +L+ Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSFANDLLK 371 >BC112901-1|AAI12902.1| 885|Homo sapiens USP37 protein protein. Length = 885 Score = 34.7 bits (76), Expect = 0.40 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 G N GNTCY N++LQ+L+ + F +L+ Sbjct: 270 GFSNLGNTCYMNAILQSLFSLQSFANDLLK 299 >AL832645-1|CAD89955.1| 979|Homo sapiens hypothetical protein protein. Length = 979 Score = 34.7 bits (76), Expect = 0.40 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 G N GNTCY N++LQ+L+ + F +L+ Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSFANDLLK 371 >AB046814-1|BAB13420.1| 931|Homo sapiens KIAA1594 protein protein. Length = 931 Score = 34.7 bits (76), Expect = 0.40 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 G N GNTCY N++LQ+L+ + F +L+ Sbjct: 294 GFSNLGNTCYMNAILQSLFSLQSFANDLLK 323 >X98296-1|CAA66942.1| 2547|Homo sapiens ubiquitin hydrolase protein. Length = 2547 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVL 354 + GL N G TCY NSV+Q LY R +L Sbjct: 1549 FVGLKNAGATCYMNSVIQQLYMIPSIRNGIL 1579 >D80012-1|BAA11507.1| 813|Homo sapiens KIAA0190 protein. Length = 813 Score = 34.3 bits (75), Expect = 0.52 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRP 336 GL+N GN CY N+ LQAL C P Sbjct: 431 GLINKGNWCYINATLQALVACPP 453 >BX537402-1|CAD97644.1| 824|Homo sapiens hypothetical protein protein. Length = 824 Score = 34.3 bits (75), Expect = 0.52 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRP 336 GL+N GN CY N+ LQAL C P Sbjct: 442 GLINKGNWCYINATLQALVACPP 464 >BC130398-1|AAI30399.1| 912|Homo sapiens USP29 protein protein. Length = 912 Score = 34.3 bits (75), Expect = 0.52 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 G N GNTCY N+VLQ+L+ F + +L Sbjct: 286 GFPNLGNTCYMNAVLQSLFAIPSFADDLL 314 >BC130394-1|AAI30395.1| 912|Homo sapiens USP29 protein protein. Length = 912 Score = 34.3 bits (75), Expect = 0.52 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 G N GNTCY N+VLQ+L+ F + +L Sbjct: 286 GFPNLGNTCYMNAVLQSLFAIPSFADDLL 314 >BC041366-1|AAH41366.1| 362|Homo sapiens USP2 protein protein. Length = 362 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 25 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 54 >BC002955-1|AAH02955.1| 605|Homo sapiens ubiquitin specific peptidase 2 protein. Length = 605 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 268 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 297 >BC002854-1|AAH02854.1| 605|Homo sapiens ubiquitin specific peptidase 2 protein. Length = 605 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 268 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 297 >BC000263-1|AAH00263.1| 798|Homo sapiens ubiquitin specific peptidase 10 protein. Length = 798 Score = 34.3 bits (75), Expect = 0.52 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRP 336 GL+N GN CY N+ LQAL C P Sbjct: 416 GLINKGNWCYINATLQALVACPP 438 >AL831918-1|CAD38579.1| 810|Homo sapiens hypothetical protein protein. Length = 810 Score = 34.3 bits (75), Expect = 0.52 Identities = 22/79 (27%), Positives = 33/79 (41%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 441 + GL N G TCY S +Q LY R+ V K +T L L +F + + Sbjct: 171 FVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESEC 230 Query: 442 KVGSIAPKKFIARLRKEKE 498 K + P+ F +K+ Sbjct: 231 K--AYNPRPFCKTYTMDKQ 247 >AL391259-2|CAD13527.2| 2547|Homo sapiens ubiquitin specific peptidase 9, X-linked protein. Length = 2547 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVL 354 + GL N G TCY NSV+Q LY R +L Sbjct: 1549 FVGLKNAGATCYMNSVIQQLYMIPSIRNGIL 1579 >AL109797-1|CAD18900.2| 2547|Homo sapiens ubiquitin specific peptidase 9, X-linked protein. Length = 2547 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVL 354 + GL N G TCY NSV+Q LY R +L Sbjct: 1549 FVGLKNAGATCYMNSVIQQLYMIPSIRNGIL 1579 >AK057225-1|BAB71388.1| 605|Homo sapiens protein ( Homo sapiens cDNA FLJ32663 fis, clone TESTI1000070, highly similar to Rattus norvegicus deubiquitinating enzyme Ubp69 (ubp69) mRNA. ). Length = 605 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 268 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 297 >AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific proteinase 34 protein. Length = 3395 Score = 34.3 bits (75), Expect = 0.52 Identities = 22/79 (27%), Positives = 33/79 (41%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 441 + GL N G TCY S +Q LY R+ V K +T L L +F + + Sbjct: 1742 FVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESEC 1801 Query: 442 KVGSIAPKKFIARLRKEKE 498 K + P+ F +K+ Sbjct: 1802 K--AYNPRPFCKTYTMDKQ 1818 >AF440755-1|AAN65363.1| 396|Homo sapiens ubiquitin specific protease 2b protein. Length = 396 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 59 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 88 >AF229438-1|AAG10401.1| 922|Homo sapiens ubiquitin-specific processing protease protein. Length = 922 Score = 34.3 bits (75), Expect = 0.52 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 G N GNTCY N+VLQ+L+ F + +L Sbjct: 286 GFPNLGNTCYMNAVLQSLFAIPSFADDLL 314 >AF079564-1|AAC28392.1| 353|Homo sapiens ubiquitin-specific protease UBP41 protein. Length = 353 Score = 34.3 bits (75), Expect = 0.52 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 16 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 45 >AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein. Length = 3412 Score = 34.3 bits (75), Expect = 0.52 Identities = 22/79 (27%), Positives = 33/79 (41%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 441 + GL N G TCY S +Q LY R+ V K +T L L +F + + Sbjct: 1759 FVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESEC 1818 Query: 442 KVGSIAPKKFIARLRKEKE 498 K + P+ F +K+ Sbjct: 1819 K--AYNPRPFCKTYTMDKQ 1835 >BC132862-1|AAI32863.1| 1316|Homo sapiens ubiquitin specific peptidase 42 protein. Length = 1316 Score = 33.9 bits (74), Expect = 0.69 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >BC060846-1|AAH60846.2| 1202|Homo sapiens USP42 protein protein. Length = 1202 Score = 33.9 bits (74), Expect = 0.69 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >AY618868-1|AAT67238.1| 1324|Homo sapiens ubiquitin specific protease 42 protein. Length = 1324 Score = 33.9 bits (74), Expect = 0.69 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >AK022759-1|BAB14232.1| 1198|Homo sapiens protein ( Homo sapiens cDNA FLJ12697 fis, clone NT2RP1000522, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 1198 Score = 33.9 bits (74), Expect = 0.69 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >AJ601395-1|CAE53097.1| 1325|Homo sapiens ubiquitin-specific protease 42 protein. Length = 1325 Score = 33.9 bits (74), Expect = 0.69 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >U20657-1|AAB72237.1| 963|Homo sapiens ubiquitin protease protein. Length = 963 Score = 33.5 bits (73), Expect = 0.91 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 378 GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 303 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >BC125131-1|AAI25132.1| 963|Homo sapiens ubiquitin specific peptidase 4 (proto-oncogene) protein. Length = 963 Score = 33.5 bits (73), Expect = 0.91 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 378 GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 303 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >BC125130-1|AAI25131.1| 963|Homo sapiens ubiquitin specific peptidase 4 (proto-oncogene) protein. Length = 963 Score = 33.5 bits (73), Expect = 0.91 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 378 GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 303 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >AK223292-1|BAD97012.1| 963|Homo sapiens ubiquitin specific protease, proto-oncogene isoform a variant protein. Length = 963 Score = 33.5 bits (73), Expect = 0.91 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 378 GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 303 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >AK222725-1|BAD96445.1| 916|Homo sapiens ubiquitin specific protease, proto-oncogene isoform b variant protein. Length = 916 Score = 33.5 bits (73), Expect = 0.91 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 378 GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 256 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 294 >AF017306-1|AAC27356.1| 916|Homo sapiens UnpES protein. Length = 916 Score = 33.5 bits (73), Expect = 0.91 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 378 GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 256 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 294 >AF017305-1|AAC27355.1| 963|Homo sapiens UnpEL protein. Length = 963 Score = 33.5 bits (73), Expect = 0.91 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 378 GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 303 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >U75362-1|AAC63405.1| 863|Homo sapiens isopeptidase T-3 protein. Length = 863 Score = 33.1 bits (72), Expect = 1.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFR 342 Y GL N GN+CY +SV+QA++ F+ Sbjct: 335 YTGLKNLGNSCYLSSVMQAIFSIPEFQ 361 >BC125123-1|AAI25124.1| 952|Homo sapiens ubiquitin specific peptidase 15 protein. Length = 952 Score = 33.1 bits (72), Expect = 1.2 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 261 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 320 Query: 448 GS 453 S Sbjct: 321 WS 322 >BC016146-1|AAH16146.1| 863|Homo sapiens ubiquitin specific peptidase 13 (isopeptidase T-3) protein. Length = 863 Score = 33.1 bits (72), Expect = 1.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFR 342 Y GL N GN+CY +SV+QA++ F+ Sbjct: 335 YTGLKNLGNSCYLSSVMQAIFSIPEFQ 361 >AY509884-1|AAR91701.1| 530|Homo sapiens deubiquitinating enzyme 3 protein. Length = 530 Score = 33.1 bits (72), Expect = 1.2 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYENASLQCLTYTPPLANYML 109 >AF153604-1|AAD41086.1| 981|Homo sapiens ubiquitin-specific protease homolog protein. Length = 981 Score = 33.1 bits (72), Expect = 1.2 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 290 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 349 Query: 448 GS 453 S Sbjct: 350 WS 351 >AF106069-1|AAD52099.1| 952|Homo sapiens deubiquitinating enzyme protein. Length = 952 Score = 33.1 bits (72), Expect = 1.2 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 261 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 320 Query: 448 GS 453 S Sbjct: 321 WS 322 >AF013990-1|AAG28973.1| 902|Homo sapiens ubiquitin C-terminal hydrolase protein. Length = 902 Score = 33.1 bits (72), Expect = 1.2 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 211 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 270 Query: 448 GS 453 S Sbjct: 271 WS 272 >AB011101-1|BAA25455.2| 952|Homo sapiens KIAA0529 protein protein. Length = 952 Score = 33.1 bits (72), Expect = 1.2 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 447 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 261 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 320 Query: 448 GS 453 S Sbjct: 321 WS 322 >D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein. Length = 1120 Score = 32.7 bits (71), Expect = 1.6 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTCY NS+LQ L Sbjct: 780 GLRNLGNTCYMNSILQCL 797 Score = 31.1 bits (67), Expect = 4.9 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTC--NGSVPHNT-EPTWVH 680 Y QQD+ E L FL++ ++E + N+ K + N+ ++ + H + + Sbjct: 866 YSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIV 925 Query: 681 EIFQGTLTSETRCLTVRRSA 740 +FQG S +CLT + + Sbjct: 926 ALFQGQFKSTVQCLTCHKKS 945 >BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein protein. Length = 1118 Score = 32.7 bits (71), Expect = 1.6 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTCY NS+LQ L Sbjct: 778 GLRNLGNTCYMNSILQCL 795 Score = 31.1 bits (67), Expect = 4.9 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTC--NGSVPHNT-EPTWVH 680 Y QQD+ E L FL++ ++E + N+ K + N+ ++ + H + + Sbjct: 864 YSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIV 923 Query: 681 EIFQGTLTSETRCLTVRRSA 740 +FQG S +CLT + + Sbjct: 924 ALFQGQFKSTVQCLTCHKKS 943 >BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific peptidase 8 protein. Length = 1118 Score = 32.7 bits (71), Expect = 1.6 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTCY NS+LQ L Sbjct: 778 GLRNLGNTCYMNSILQCL 795 Score = 31.1 bits (67), Expect = 4.9 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = +3 Query: 510 YMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTC--NGSVPHNT-EPTWVH 680 Y QQD+ E L FL++ ++E + N+ K + N+ ++ + H + + Sbjct: 864 YSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIV 923 Query: 681 EIFQGTLTSETRCLTVRRSA 740 +FQG S +CLT + + Sbjct: 924 ALFQGQFKSTVQCLTCHKKS 943 >BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein. Length = 1123 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 182 GNAIKPVSFIRDLKKIARHF 201 >BC038983-1|AAH38983.1| 285|Homo sapiens USP36 protein protein. Length = 285 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 182 GNAIKPVSFIRDLKKIARHF 201 >BC027992-1|AAH27992.1| 959|Homo sapiens USP36 protein protein. Length = 959 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 182 GNAIKPVSFIRDLKKIARHF 201 >BC016487-1|AAH16487.1| 963|Homo sapiens Unknown (protein for IMAGE:3924730) protein. Length = 963 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 182 GNAIKPVSFIRDLKKIARHF 201 >AY169386-1|AAO34133.1| 548|Homo sapiens deubiquitinating enzyme 1 protein. Length = 548 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 182 GNAIKPVSFIRDLKKIARHF 201 >AK022913-1|BAB14306.1| 548|Homo sapiens protein ( Homo sapiens cDNA FLJ12851 fis, clone NT2RP2003401, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 548 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 182 GNAIKPVSFIRDLKKIARHF 201 >AK001671-1|BAA91825.1| 954|Homo sapiens protein ( Homo sapiens cDNA FLJ10809 fis, clone NT2RP4000927, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 954 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 182 GNAIKPVSFIRDLKKIARHF 201 >AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein. Length = 1123 Score = 32.7 bits (71), Expect = 1.6 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 444 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 125 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 183 Query: 445 VGSIAPKKFIARLRKEKEEF 504 +I P FI L+K F Sbjct: 184 GNAIKPVSFIRDLKKIARHF 203 >U30888-1|AAB60365.1| 494|Homo sapiens tRNA-Guanine Transglycosylase protein. Length = 494 Score = 32.3 bits (70), Expect = 2.1 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEY----KAKNKRTKETLLT-CLADLFYSIAT 432 GL N GNTCY N+ +Q + ++ + Y +A + +T L DLF S+ Sbjct: 106 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 165 Query: 433 QKKKVGSIAPKKFI 474 + I +F+ Sbjct: 166 TSSSIPPIILLQFL 179 >BX640815-1|CAE45893.1| 453|Homo sapiens hypothetical protein protein. Length = 453 Score = 32.3 bits (70), Expect = 2.1 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 417 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 105 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 156 >BX538024-1|CAD97970.1| 979|Homo sapiens hypothetical protein protein. Length = 979 Score = 32.3 bits (70), Expect = 2.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 357 G GNTCY N++LQ+L+ + F +L+ Sbjct: 342 GFSKLGNTCYMNAILQSLFSLQSFANDLLK 371 >BT007183-1|AAP35847.1| 494|Homo sapiens ubiquitin specific protease 14 (tRNA-guanine transglycosylase) protein. Length = 494 Score = 32.3 bits (70), Expect = 2.1 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEY----KAKNKRTKETLLT-CLADLFYSIAT 432 GL N GNTCY N+ +Q + ++ + Y +A + +T L DLF S+ Sbjct: 106 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 165 Query: 433 QKKKVGSIAPKKFI 474 + I +F+ Sbjct: 166 TSSSIPPIILLQFL 179 >BC126898-1|AAI26899.1| 513|Homo sapiens USP22 protein protein. Length = 513 Score = 32.3 bits (70), Expect = 2.1 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 417 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 165 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 216 >BC110499-1|AAI10500.1| 512|Homo sapiens USP22 protein protein. Length = 512 Score = 32.3 bits (70), Expect = 2.1 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 417 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 164 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 215 >BC003556-1|AAH03556.1| 494|Homo sapiens ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) protein. Length = 494 Score = 32.3 bits (70), Expect = 2.1 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEY----KAKNKRTKETLLT-CLADLFYSIAT 432 GL N GNTCY N+ +Q + ++ + Y +A + +T L DLF S+ Sbjct: 106 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 165 Query: 433 QKKKVGSIAPKKFI 474 + I +F+ Sbjct: 166 TSSSIPPIILLQFL 179 >AY533200-1|AAS59847.1| 398|Homo sapiens deubiquitinating enzyme DUB4 protein. Length = 398 Score = 32.3 bits (70), Expect = 2.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AY188990-1|AAO38845.1| 530|Homo sapiens deubiquitinating enzyme 3 protein. Length = 530 Score = 32.3 bits (70), Expect = 2.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AF544012-1|AAQ11742.1| 530|Homo sapiens deubiquitinating enzyme DUB2 protein. Length = 530 Score = 32.3 bits (70), Expect = 2.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AF544011-1|AAQ11741.1| 530|Homo sapiens deubiquitinating enzyme DUB1 protein. Length = 530 Score = 32.3 bits (70), Expect = 2.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVL 354 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific protease USP32 protein. Length = 1604 Score = 32.3 bits (70), Expect = 2.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 244 VPTYEHYFGLVNFGNTCYSNSVLQALYFCRPFRE 345 VPT + GL N GNTC+ NS +Q + +P + Sbjct: 727 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQ 760 >AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific protease protein. Length = 1274 Score = 32.3 bits (70), Expect = 2.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 244 VPTYEHYFGLVNFGNTCYSNSVLQALYFCRPFRE 345 VPT + GL N GNTC+ NS +Q + +P + Sbjct: 397 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQ 430 >AF155116-1|AAD42882.1| 828|Homo sapiens NY-REN-60 antigen protein. Length = 828 Score = 32.3 bits (70), Expect = 2.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 244 VPTYEHYFGLVNFGNTCYSNSVLQALYFCRPFRE 345 VPT + GL N GNTC+ NS +Q + +P + Sbjct: 192 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQ 225 >AB028986-1|BAA83015.1| 593|Homo sapiens KIAA1063 protein protein. Length = 593 Score = 32.3 bits (70), Expect = 2.1 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 417 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 245 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 296 >AF073344-1|AAD42992.1| 521|Homo sapiens ubiquitin-specific protease 3 protein. Length = 521 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL----YFCRPFRE 345 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >U44839-1|AAC50450.1| 690|Homo sapiens UHX1 protein protein. Length = 690 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTC+ NS LQ L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >BC063668-1|AAH63668.1| 923|Homo sapiens USP11 protein protein. Length = 923 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTC+ NS LQ L Sbjct: 270 GLTNLGNTCFMNSALQCL 287 >BC030777-1|AAH30777.1| 822|Homo sapiens ubiquitin specific peptidase 16 protein. Length = 822 Score = 31.1 bits (67), Expect = 4.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ N+V+Q L RE + E K Sbjct: 196 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 227 >BC000350-1|AAH00350.4| 921|Homo sapiens USP11 protein protein. Length = 921 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTC+ NS LQ L Sbjct: 268 GLTNLGNTCFMNSALQCL 285 >AY333928-1|AAR13293.1| 408|Homo sapiens USP16 protein. Length = 408 Score = 31.1 bits (67), Expect = 4.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AL163249-3|CAB90432.1| 823|Homo sapiens human ubiquitin processing protease, EC 3.1.2.15 protein. Length = 823 Score = 31.1 bits (67), Expect = 4.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AL096791-3|CAD20056.1| 690|Homo sapiens ubiquitin specific peptidase 11 protein. Length = 690 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTC+ NS LQ L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >AL096791-2|CAI42996.1| 140|Homo sapiens ubiquitin specific peptidase 11 protein. Length = 140 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTC+ NS LQ L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >AK222884-1|BAD96604.1| 823|Homo sapiens ubiquitin specific protease 16 isoform a variant protein. Length = 823 Score = 31.1 bits (67), Expect = 4.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AK222681-1|BAD96401.1| 823|Homo sapiens ubiquitin specific protease 16 isoform a variant protein. Length = 823 Score = 31.1 bits (67), Expect = 4.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AF126736-1|AAD20949.1| 823|Homo sapiens ubiquitin processing protease protein. Length = 823 Score = 31.1 bits (67), Expect = 4.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 363 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AB073597-1|BAC20463.1| 921|Homo sapiens deubiquitinating enzyme protein. Length = 921 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 268 GLVNFGNTCYSNSVLQAL 321 GL N GNTC+ NS LQ L Sbjct: 268 GLTNLGNTCFMNSALQCL 285 >AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens cDNA FLJ45132 fis, clone BRAWH3037979, highly similar to Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15). ). Length = 1332 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQK 438 + GL N G TCY N+V Q LY E +L +++ + LF + K Sbjct: 938 FVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSLFGHLMESK 996 >AB028980-1|BAA83009.1| 977|Homo sapiens KIAA1057 protein protein. Length = 977 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = +1 Query: 262 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQK 438 + GL N G TCY N+V Q LY E +L +++ + LF + K Sbjct: 45 FVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSLFGHLMESK 103 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,238,583 Number of Sequences: 237096 Number of extensions: 2284849 Number of successful extensions: 4802 Number of sequences better than 10.0: 170 Number of HSP's better than 10.0 without gapping: 4510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4785 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9924838204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -