SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK075386-1|BAC11586.1|  860|Homo sapiens protein ( Homo sapiens ...    31   1.8  
BC011765-1|AAH11765.1|  449|Homo sapiens chromosome 11 open read...    31   2.3  
AY358754-1|AAQ89114.1|  449|Homo sapiens C11orf24 protein.             31   2.3  
AF264781-1|AAG36936.1|  449|Homo sapiens DM4E3 protein.                31   2.3  
BC042683-1|AAH42683.1|  502|Homo sapiens TTC13 protein protein.        31   3.1  
AL844165-2|CAI15331.1|  806|Homo sapiens tetratricopeptide repea...    31   3.1  
AL844165-1|CAI15330.1|  860|Homo sapiens tetratricopeptide repea...    31   3.1  
AL591292-2|CAI17216.1|  806|Homo sapiens tetratricopeptide repea...    31   3.1  
AL591292-1|CAI17217.1|  860|Homo sapiens tetratricopeptide repea...    31   3.1  
AK075561-1|BAC11700.1|  806|Homo sapiens protein ( Homo sapiens ...    31   3.1  
X04701-1|CAA28407.1|  705|Homo sapiens protein ( Human mRNA for ...    30   5.4  
M14058-1|AAA51851.1|  705|Homo sapiens C1R protein.                    30   5.4  
BC035220-1|AAH35220.1|  705|Homo sapiens complement component 1,...    30   5.4  
AB083037-1|BAC19850.2|  705|Homo sapiens r subcomponent of compl...    30   5.4  
BC126910-1|AAI26911.2| 1768|Homo sapiens TNS1 protein protein.         29   9.4  
BC116188-1|AAI16189.1| 1713|Homo sapiens TNS1 protein protein.         29   9.4  
AK127311-1|BAC86927.1|  223|Homo sapiens protein ( Homo sapiens ...    29   9.4  
AB209238-1|BAD92475.1|  873|Homo sapiens tensin variant protein.       29   9.4  

>AK075386-1|BAC11586.1|  860|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0076 fis, clone NT2RP2003471, weakly similar to
           MITOCHONDRIAL PRECURSOR PROTEINS IMPORT RECEPTOR3. ).
          Length = 860

 Score = 31.5 bits (68), Expect = 1.8
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -3

Query: 369 RAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +A   ++   PLP  + S E +KV   +  SR   +HL TPL + YN
Sbjct: 406 KAQTKVMLNDPLPGQKASPEYLKVKYLREYSRHLHAHLDTPL-TEYN 451


>BC011765-1|AAH11765.1|  449|Homo sapiens chromosome 11 open reading
           frame 24 protein.
          Length = 449

 Score = 31.1 bits (67), Expect = 2.3
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 7/116 (6%)
 Frame = -3

Query: 492 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNR--- 322
           Q+ + S  PR A  +   TR    AT+ + +SP+ T  +  +        +P+PP R   
Sbjct: 194 QVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQA 253

Query: 321 ---VSNETM-KVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVP 166
              +S  ++ + VV        +   +TP  +P    + ++   +  P  SP PVP
Sbjct: 254 QGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREPTASPVPVP 309


>AY358754-1|AAQ89114.1|  449|Homo sapiens C11orf24 protein.
          Length = 449

 Score = 31.1 bits (67), Expect = 2.3
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 7/116 (6%)
 Frame = -3

Query: 492 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNR--- 322
           Q+ + S  PR A  +   TR    AT+ + +SP+ T  +  +        +P+PP R   
Sbjct: 194 QVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQA 253

Query: 321 ---VSNETM-KVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVP 166
              +S  ++ + VV        +   +TP  +P    + ++   +  P  SP PVP
Sbjct: 254 QGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREPTASPVPVP 309


>AF264781-1|AAG36936.1|  449|Homo sapiens DM4E3 protein.
          Length = 449

 Score = 31.1 bits (67), Expect = 2.3
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 7/116 (6%)
 Frame = -3

Query: 492 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNR--- 322
           Q+ + S  PR A  +   TR    AT+ + +SP+ T  +  +        +P+PP R   
Sbjct: 194 QVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQA 253

Query: 321 ---VSNETM-KVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVP 166
              +S  ++ + VV        +   +TP  +P    + ++   +  P  SP PVP
Sbjct: 254 QGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREPTASPVPVP 309


>BC042683-1|AAH42683.1|  502|Homo sapiens TTC13 protein protein.
          Length = 502

 Score = 30.7 bits (66), Expect = 3.1
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -3

Query: 369 RAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +A   ++   PLP  + S E +KV   +  SR   +HL TPL + YN
Sbjct: 49  KAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLHAHLDTPL-TEYN 94


>AL844165-2|CAI15331.1|  806|Homo sapiens tetratricopeptide repeat
           domain 13 protein.
          Length = 806

 Score = 30.7 bits (66), Expect = 3.1
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -3

Query: 369 RAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +A   ++   PLP  + S E +KV   +  SR   +HL TPL + YN
Sbjct: 353 KAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLHAHLDTPL-TEYN 398


>AL844165-1|CAI15330.1|  860|Homo sapiens tetratricopeptide repeat
           domain 13 protein.
          Length = 860

 Score = 30.7 bits (66), Expect = 3.1
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -3

Query: 369 RAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +A   ++   PLP  + S E +KV   +  SR   +HL TPL + YN
Sbjct: 406 KAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLHAHLDTPL-TEYN 451


>AL591292-2|CAI17216.1|  806|Homo sapiens tetratricopeptide repeat
           domain 13 protein.
          Length = 806

 Score = 30.7 bits (66), Expect = 3.1
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -3

Query: 369 RAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +A   ++   PLP  + S E +KV   +  SR   +HL TPL + YN
Sbjct: 353 KAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLHAHLDTPL-TEYN 398


>AL591292-1|CAI17217.1|  860|Homo sapiens tetratricopeptide repeat
           domain 13 protein.
          Length = 860

 Score = 30.7 bits (66), Expect = 3.1
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -3

Query: 369 RAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +A   ++   PLP  + S E +KV   +  SR   +HL TPL + YN
Sbjct: 406 KAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLHAHLDTPL-TEYN 451


>AK075561-1|BAC11700.1|  806|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0261 fis, clone NT2RP3004063, weakly similar to
           MITOCHONDRIAL PRECURSOR PROTEINS IMPORT RECEPTOR. ).
          Length = 806

 Score = 30.7 bits (66), Expect = 3.1
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -3

Query: 369 RAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +A   ++   PLP  + S E +KV   +  SR   +HL TPL + YN
Sbjct: 353 KAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLHAHLDTPL-TEYN 398


>X04701-1|CAA28407.1|  705|Homo sapiens protein ( Human mRNA for
           complement component C1r. ).
          Length = 705

 Score = 29.9 bits (64), Expect = 5.4
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 113 D*RDSHCPYLLSSETTAKGTGLGESAGKADPVELDSS 223
           D +  HCPY    +  A G  +GE  GK  P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>M14058-1|AAA51851.1|  705|Homo sapiens C1R protein.
          Length = 705

 Score = 29.9 bits (64), Expect = 5.4
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 113 D*RDSHCPYLLSSETTAKGTGLGESAGKADPVELDSS 223
           D +  HCPY    +  A G  +GE  GK  P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>BC035220-1|AAH35220.1|  705|Homo sapiens complement component 1, r
           subcomponent protein.
          Length = 705

 Score = 29.9 bits (64), Expect = 5.4
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 113 D*RDSHCPYLLSSETTAKGTGLGESAGKADPVELDSS 223
           D +  HCPY    +  A G  +GE  GK  P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>AB083037-1|BAC19850.2|  705|Homo sapiens r subcomponent of
           complement component 1 protein.
          Length = 705

 Score = 29.9 bits (64), Expect = 5.4
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 113 D*RDSHCPYLLSSETTAKGTGLGESAGKADPVELDSS 223
           D +  HCPY    +  A G  +GE  GK  P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>BC126910-1|AAI26911.2| 1768|Homo sapiens TNS1 protein protein.
          Length = 1768

 Score = 29.1 bits (62), Expect = 9.4
 Identities = 23/91 (25%), Positives = 35/91 (38%), Gaps = 3/91 (3%)
 Frame = -3

Query: 405  ATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRE-XISHLSTPLMSPYN 229
            A +PL  LG     PADI+      P        +  V   R+++      S P    Y 
Sbjct: 1030 AKTPLSALGLKPHNPADILLHPTGEPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYG 1089

Query: 228  AR--LESSSTGSAFPADSPKPVPLAVVSLDS 142
                L + + G +F + SP      ++S DS
Sbjct: 1090 HEIPLRNGTLGGSFVSPSPLSTSSPILSADS 1120


>BC116188-1|AAI16189.1| 1713|Homo sapiens TNS1 protein protein.
          Length = 1713

 Score = 29.1 bits (62), Expect = 9.4
 Identities = 23/91 (25%), Positives = 35/91 (38%), Gaps = 3/91 (3%)
 Frame = -3

Query: 405  ATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRE-XISHLSTPLMSPYN 229
            A +PL  LG     PADI+      P        +  V   R+++      S P    Y 
Sbjct: 975  AKTPLSALGLKPHNPADILLHPTGEPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYG 1034

Query: 228  AR--LESSSTGSAFPADSPKPVPLAVVSLDS 142
                L + + G +F + SP      ++S DS
Sbjct: 1035 HEIPLRNGTLGGSFVSPSPLSTSSPILSADS 1065


>AK127311-1|BAC86927.1|  223|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45380 fis, clone BRHIP3020733. ).
          Length = 223

 Score = 29.1 bits (62), Expect = 9.4
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -3

Query: 420 ATSVSATSPLCTLGTTHRAPADIIDRAPLPPNR 322
           A S+ A +P C L   HR    + D   LPP+R
Sbjct: 154 APSLPAQAPWCLLSPGHRGATSLPDTMMLPPSR 186


>AB209238-1|BAD92475.1|  873|Homo sapiens tensin variant protein.
          Length = 873

 Score = 29.1 bits (62), Expect = 9.4
 Identities = 23/91 (25%), Positives = 35/91 (38%), Gaps = 3/91 (3%)
 Frame = -3

Query: 405 ATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRE-XISHLSTPLMSPYN 229
           A +PL  LG     PADI+      P        +  V   R+++      S P    Y 
Sbjct: 135 AKTPLSALGLKPHNPADILLHPTGEPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYG 194

Query: 228 AR--LESSSTGSAFPADSPKPVPLAVVSLDS 142
               L + + G +F + SP      ++S DS
Sbjct: 195 HEIPLRNGTLGGSFVSPSPLSTSSPILSADS 225


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,585,010
Number of Sequences: 237096
Number of extensions: 1732879
Number of successful extensions: 4535
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 4264
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4534
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4763295768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).