SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0079
         (617 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for MG...    47   5e-05
BC048251-1|AAH48251.1|  322|Homo sapiens ZDHHC12 protein protein.      32   1.9  
AL441992-6|CAI15406.1|  210|Homo sapiens zinc finger, DHHC-type ...    32   1.9  
AY750848-1|AAU81930.1| 1032|Homo sapiens RTN3-A1 protein.              31   4.3  
AY427821-1|AAR02474.1| 1013|Homo sapiens reticulon 3-A protein.        31   4.3  
EF623992-1|ABR25252.1|  354|Homo sapiens Uba6-specific E2 conjug...    30   7.5  
BC016757-1|AAH16757.1|  220|Homo sapiens Sin3A-associated protei...    30   7.5  
AF055993-1|AAC33316.1|  220|Homo sapiens mSin3A associated polyp...    30   7.5  

>BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for
           MGC:134704) protein.
          Length = 44

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 19/23 (82%), Positives = 21/23 (91%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGT 572
           K++VAMNAW PQASYPCGNFS T
Sbjct: 11  KSDVAMNAWPPQASYPCGNFSDT 33


>BC048251-1|AAH48251.1|  322|Homo sapiens ZDHHC12 protein protein.
          Length = 322

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = -3

Query: 309 HALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESRE 178
           H    A  G   P++  C TP  P P  P PA +CS  SPE R+
Sbjct: 51  HLQAFAQPGTHFPTSN-C-TPTPPTPVLPGPASLCSPASPELRQ 92


>AL441992-6|CAI15406.1|  210|Homo sapiens zinc finger, DHHC-type
           containing 12 protein.
          Length = 210

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = -3

Query: 309 HALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESRE 178
           H    A  G   P++  C TP  P P  P PA +CS  SPE R+
Sbjct: 51  HLQAFAQPGTHFPTSN-C-TPTPPTPVLPGPASLCSPASPELRQ 92


>AY750848-1|AAU81930.1| 1032|Homo sapiens RTN3-A1 protein.
          Length = 1032

 Score = 30.7 bits (66), Expect = 4.3
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 6/65 (9%)
 Frame = -2

Query: 280 EATIRGIMPNASKAEASLAESGKDMLTVEP------RESGGSKQCDFTSRVSHSKRETRR 119
           E   +GI+ +   A  +++E   D  T  P       ESGGS+  D  S+ S   +ET  
Sbjct: 660 ETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNG 719

Query: 118 RSPFG 104
             P G
Sbjct: 720 SEPLG 724


>AY427821-1|AAR02474.1| 1013|Homo sapiens reticulon 3-A protein.
          Length = 1013

 Score = 30.7 bits (66), Expect = 4.3
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 6/65 (9%)
 Frame = -2

Query: 280 EATIRGIMPNASKAEASLAESGKDMLTVEP------RESGGSKQCDFTSRVSHSKRETRR 119
           E   +GI+ +   A  +++E   D  T  P       ESGGS+  D  S+ S   +ET  
Sbjct: 641 ETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNG 700

Query: 118 RSPFG 104
             P G
Sbjct: 701 SEPLG 705


>EF623992-1|ABR25252.1|  354|Homo sapiens Uba6-specific E2
           conjugating enzyme 1 protein.
          Length = 354

 Score = 29.9 bits (64), Expect = 7.5
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = -3

Query: 312 VHALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSP 190
           V A   AAGGA  P +GL   P  P  A  + A + S W P
Sbjct: 45  VWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDP 85


>BC016757-1|AAH16757.1|  220|Homo sapiens Sin3A-associated protein,
           30kDa protein.
          Length = 220

 Score = 29.9 bits (64), Expect = 7.5
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 3/73 (4%)
 Frame = -3

Query: 300 GRAAG-GAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESR--EALNNVTLLVAFRIQNA 130
           G  AG GA++P AG       P  A P P ++C L     R   A  N +     +   +
Sbjct: 35  GTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSIS 94

Query: 129 RRDVEAHLDRGDR 91
           ++ V+  LD+  R
Sbjct: 95  QKKVKIELDKSAR 107


>AF055993-1|AAC33316.1|  220|Homo sapiens mSin3A associated
           polypeptide p30 protein.
          Length = 220

 Score = 29.9 bits (64), Expect = 7.5
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 3/73 (4%)
 Frame = -3

Query: 300 GRAAG-GAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESR--EALNNVTLLVAFRIQNA 130
           G  AG GA++P AG       P  A P P ++C L     R   A  N +     +   +
Sbjct: 35  GTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSIS 94

Query: 129 RRDVEAHLDRGDR 91
           ++ V+  LD+  R
Sbjct: 95  QKKVKIELDKSAR 107


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,166,562
Number of Sequences: 237096
Number of extensions: 2027758
Number of successful extensions: 4894
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 4713
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4893
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6635341780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).