SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ...    32   1.8  
AL583839-8|CAO03351.1| 1772|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL583839-7|CAO03350.1| 2219|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL583839-6|CAI12344.3| 2297|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL390760-4|CAO03648.1| 1772|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL390760-3|CAO03647.1| 2219|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL390760-1|CAH73069.3| 2297|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL354991-4|CAO03640.1| 1772|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL354991-3|CAO03639.1| 2219|Homo sapiens WNK lysine deficient pr...    31   3.1  
AL354991-2|CAI14449.3| 2297|Homo sapiens WNK lysine deficient pr...    31   3.1  
AJ242724-1|CAB44308.5| 2297|Homo sapiens putative mitogen-activa...    31   3.1  
AB051547-1|BAB21851.2| 2219|Homo sapiens KIAA1760 protein protein.     31   3.1  
BC128390-1|AAI28391.1| 1682|Homo sapiens ADAMTSL3 protein protein.     30   5.5  
BC128389-1|AAI28390.1| 1691|Homo sapiens ADAMTS-like 3 protein.        30   5.5  
AB033059-1|BAA86547.1| 1023|Homo sapiens KIAA1233 protein protein.     30   5.5  
AY396741-1|AAR91619.1| 2850|Homo sapiens hornerin precursor prot...    30   7.3  
AL589986-3|CAH70026.1| 2850|Homo sapiens hornerin protein.             30   7.3  
Z15025-1|CAA78744.1| 1870|Homo sapiens Bat2 protein.                   29   9.6  
M33518-1|AAA35586.1| 2142|Homo sapiens protein ( Human HLA-B-ass...    29   9.6  
M33509-1|AAA35585.1| 2142|Homo sapiens protein ( Human HLA-B-ass...    29   9.6  
BX511262-1|CAI95572.1| 2157|Homo sapiens HLA-B associated transc...    29   9.6  
BC142608-1|AAI42609.1|  202|Homo sapiens AIRE protein protein.         29   9.6  
BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein.        29   9.6  
BC060668-1|AAH60668.1| 2157|Homo sapiens HLA-B associated transc...    29   9.6  
BC042295-1|AAH42295.1| 2157|Homo sapiens BAT2 protein protein.         29   9.6  
BC027992-1|AAH27992.1|  959|Homo sapiens USP36 protein protein.        29   9.6  
BC016487-1|AAH16487.1|  963|Homo sapiens Unknown (protein for IM...    29   9.6  
BA000025-31|BAB63391.1| 2157|Homo sapiens BAT2 protein.                29   9.6  
AY210419-1|AAO34702.1| 3501|Homo sapiens CUB and sushi multiple ...    29   9.6  
AL805934-4|CAI18500.1| 2157|Homo sapiens HLA-B associated transc...    29   9.6  
AL662847-63|CAI17698.2| 2157|Homo sapiens HLA-B associated trans...    29   9.6  
AL662801-47|CAI18313.1| 2157|Homo sapiens HLA-B associated trans...    29   9.6  
AK001671-1|BAA91825.1|  954|Homo sapiens protein ( Homo sapiens ...    29   9.6  
AF129756-17|AAD18086.1| 2157|Homo sapiens BAT2 protein.                29   9.6  
AB114605-1|BAC82444.1| 3667|Homo sapiens CSMD3 protein isoform 2...    29   9.6  
AB114604-1|BAC82443.1| 3707|Homo sapiens CSMD3 protein isoform 1...    29   9.6  
AB067481-1|BAB67787.2| 2977|Homo sapiens KIAA1894 protein protein.     29   9.6  
AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein.     29   9.6  
AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein.     29   9.6  

>AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor
            marker CA125 protein.
          Length = 22152

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = -2

Query: 421  FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVA 317
            F+ + PS+   +   + SPES P SPLPVT ++ +
Sbjct: 5634 FSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668


>AL583839-8|CAO03351.1| 1772|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 1772

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 442 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 485


>AL583839-7|CAO03350.1| 2219|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 2219

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 834 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 877


>AL583839-6|CAI12344.3| 2297|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 2297

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 839 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 882


>AL390760-4|CAO03648.1| 1772|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 1772

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 442 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 485


>AL390760-3|CAO03647.1| 2219|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 2219

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 834 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 877


>AL390760-1|CAH73069.3| 2297|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 2297

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 839 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 882


>AL354991-4|CAO03640.1| 1772|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 1772

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 442 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 485


>AL354991-3|CAO03639.1| 2219|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 2219

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 834 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 877


>AL354991-2|CAI14449.3| 2297|Homo sapiens WNK lysine deficient
           protein kinase 2 protein.
          Length = 2297

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 839 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 882


>AJ242724-1|CAB44308.5| 2297|Homo sapiens putative mitogen-activated
           protein kinase kinase kinase protein.
          Length = 2297

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 839 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 882


>AB051547-1|BAB21851.2| 2219|Homo sapiens KIAA1760 protein protein.
          Length = 2219

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = -1

Query: 539 VCDALRCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAPA 408
           +  +L  P PP +          P  PG PL +PCR  V  APA
Sbjct: 834 ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPA 877


>BC128390-1|AAI28391.1| 1682|Homo sapiens ADAMTSL3 protein protein.
          Length = 1682

 Score = 30.3 bits (65), Expect = 5.5
 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = +1

Query: 439 GSFSGLPGPLGQGEHADSF-SVARGG-PGHLRASQTCYCSISCG 564
           GSF  L   L QG  A S  S AR   P HL       CS+SCG
Sbjct: 793 GSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCG 836


>BC128389-1|AAI28390.1| 1691|Homo sapiens ADAMTS-like 3 protein.
          Length = 1691

 Score = 30.3 bits (65), Expect = 5.5
 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = +1

Query: 439 GSFSGLPGPLGQGEHADSF-SVARGG-PGHLRASQTCYCSISCG 564
           GSF  L   L QG  A S  S AR   P HL       CS+SCG
Sbjct: 793 GSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCG 836


>AB033059-1|BAA86547.1| 1023|Homo sapiens KIAA1233 protein protein.
          Length = 1023

 Score = 30.3 bits (65), Expect = 5.5
 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = +1

Query: 439 GSFSGLPGPLGQGEHADSF-SVARGG-PGHLRASQTCYCSISCG 564
           GSF  L   L QG  A S  S AR   P HL       CS+SCG
Sbjct: 125 GSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCG 168


>AY396741-1|AAR91619.1| 2850|Homo sapiens hornerin precursor
           protein.
          Length = 2850

 Score = 29.9 bits (64), Expect = 7.3
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
 Frame = +1

Query: 388 LPHPRKAAGAQIT--HSRHGSFSGLPGPLGQGEHADSFSVARG 510
           L H R+ +G++ +  H RHGS SG     GQ     S+S +RG
Sbjct: 294 LGHGRQGSGSRQSPSHVRHGSGSGHSSSHGQHGSGSSYSYSRG 336


>AL589986-3|CAH70026.1| 2850|Homo sapiens hornerin protein.
          Length = 2850

 Score = 29.9 bits (64), Expect = 7.3
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
 Frame = +1

Query: 388 LPHPRKAAGAQIT--HSRHGSFSGLPGPLGQGEHADSFSVARG 510
           L H R+ +G++ +  H RHGS SG     GQ     S+S +RG
Sbjct: 294 LGHGRQGSGSRQSPSHVRHGSGSGHSSSHGQHGSGSSYSYSRG 336


>Z15025-1|CAA78744.1| 1870|Homo sapiens Bat2 protein.
          Length = 1870

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1178 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1234

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1235 RPRRRRHG 1242


>M33518-1|AAA35586.1| 2142|Homo sapiens protein ( Human
            HLA-B-associated transcript 2 (BAT2) gene, 3' end. ).
          Length = 2142

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1167 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1223

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1224 RPRRRRHG 1231


>M33509-1|AAA35585.1| 2142|Homo sapiens protein ( Human
            HLA-B-associated transcript 2 (BAT2) mRNA, complete cds.
            ).
          Length = 2142

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1167 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1223

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1224 RPRRRRHG 1231


>BX511262-1|CAI95572.1| 2157|Homo sapiens HLA-B associated transcript
            2 protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>BC142608-1|AAI42609.1|  202|Homo sapiens AIRE protein protein.
          Length = 202

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 21/71 (29%), Positives = 26/71 (36%)
 Frame = +1

Query: 364 PEREPEKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTC 543
           P R P KR       A A    +  G+ S  PG L  GE +     +R  PG    S   
Sbjct: 125 PPRLPTKRKASEEARAAAPAALTPRGTAS--PGTLPAGEASQGLQSSRASPGAHAPSPPG 182

Query: 544 YCSISCGSKTP 576
                CG+  P
Sbjct: 183 LPPTGCGASLP 193


>BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein.
          Length = 1123

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +1

Query: 433 RHGSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSISCGSKTP 576
           R GS S  P      +   +    R G  HL  SQ   CS +  SKTP
Sbjct: 607 RRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTP 654


>BC060668-1|AAH60668.1| 2157|Homo sapiens HLA-B associated transcript
            2 protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>BC042295-1|AAH42295.1| 2157|Homo sapiens BAT2 protein protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>BC027992-1|AAH27992.1|  959|Homo sapiens USP36 protein protein.
          Length = 959

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +1

Query: 433 RHGSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSISCGSKTP 576
           R GS S  P      +   +    R G  HL  SQ   CS +  SKTP
Sbjct: 607 RRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTP 654


>BC016487-1|AAH16487.1|  963|Homo sapiens Unknown (protein for
           IMAGE:3924730) protein.
          Length = 963

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +1

Query: 433 RHGSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSISCGSKTP 576
           R GS S  P      +   +    R G  HL  SQ   CS +  SKTP
Sbjct: 607 RRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTP 654


>BA000025-31|BAB63391.1| 2157|Homo sapiens BAT2 protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>AY210419-1|AAO34702.1| 3501|Homo sapiens CUB and sushi multiple
            domains 3 protein.
          Length = 3501

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = -1

Query: 434  REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 327
            R W    P+    CG RF G  SG  + P +P   DN+
Sbjct: 1260 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1297


>AL805934-4|CAI18500.1| 2157|Homo sapiens HLA-B associated transcript
            2 protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>AL662847-63|CAI17698.2| 2157|Homo sapiens HLA-B associated transcript
            2 protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>AL662801-47|CAI18313.1| 2157|Homo sapiens HLA-B associated transcript
            2 protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>AK001671-1|BAA91825.1|  954|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10809 fis, clone NT2RP4000927, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC
           3.1.2.15). ).
          Length = 954

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +1

Query: 433 RHGSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSISCGSKTP 576
           R GS S  P      +   +    R G  HL  SQ   CS +  SKTP
Sbjct: 607 RRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTP 654


>AF129756-17|AAD18086.1| 2157|Homo sapiens BAT2 protein.
          Length = 2157

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = -1

Query: 521  CPG--PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLSGIEP*F 348
            CPG  PP  +L      P P GP  P K P +E +I  P + +  G    GS  G+E   
Sbjct: 1182 CPGWSPPAKSLAPK--KP-PTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGE 1238

Query: 347  PVTRDNHG 324
               R  HG
Sbjct: 1239 RPRRRRHG 1246


>AB114605-1|BAC82444.1| 3667|Homo sapiens CSMD3 protein isoform 2
            protein.
          Length = 3667

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = -1

Query: 434  REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 327
            R W    P+    CG RF G  SG  + P +P   DN+
Sbjct: 1361 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1398


>AB114604-1|BAC82443.1| 3707|Homo sapiens CSMD3 protein isoform 1
            protein.
          Length = 3707

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = -1

Query: 434  REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 327
            R W    P+    CG RF G  SG  + P +P   DN+
Sbjct: 1401 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1438


>AB067481-1|BAB67787.2| 2977|Homo sapiens KIAA1894 protein protein.
          Length = 2977

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = -1

Query: 434 REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 327
           R W    P+    CG RF G  SG  + P +P   DN+
Sbjct: 741 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 778


>AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein.
          Length = 1134

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -1

Query: 512  PPRATLKESACSPWPRGPGNP 450
            PPR+    SAC PW  GP +P
Sbjct: 1094 PPRSWPSGSACRPWRTGPRSP 1114


>AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein.
          Length = 1123

 Score = 29.5 bits (63), Expect = 9.6
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = +1

Query: 433 RHGSFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSISCGSKTP 576
           R GS S  P      +   +    R G  HL  SQ   CS +  SKTP
Sbjct: 609 RRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTP 656


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,415,913
Number of Sequences: 237096
Number of extensions: 2182788
Number of successful extensions: 7072
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 6512
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7070
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6410414940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).