SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   103   2e-22
X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           103   2e-22
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   103   2e-22
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 103   2e-22
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   103   2e-22
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          103   2e-22
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   103   2e-22
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       103   2e-22
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   103   2e-22
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         103   2e-22
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       103   2e-22
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       103   2e-22
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         103   2e-22
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         103   2e-22
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        103   2e-22
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         103   2e-22
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         103   2e-22
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         103   2e-22
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       103   2e-22
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         103   2e-22
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      103   2e-22
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         103   2e-22
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   103   2e-22
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   103   2e-22
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   103   2e-22
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             103   2e-22
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   103   2e-22
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   103   2e-22
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 103   2e-22
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 103   2e-22
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   103   2e-22
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 103   2e-22
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   103   2e-22
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               103   2e-22
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                103   2e-22
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               103   2e-22
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               103   2e-22
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               103   2e-22
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               103   2e-22
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       103   2e-22
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   103   2e-22
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   103   2e-22
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   103   2e-22
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   103   2e-22
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   103   2e-22
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   103   2e-22
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   103   2e-22
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   103   2e-22
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   103   2e-22
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   103   2e-22
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   103   2e-22
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   103   2e-22
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             103   2e-22
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 100   1e-21
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...    90   3e-18
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...    87   1e-17
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.        60   2e-09
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.       60   2e-09
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...    60   2e-09
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...    60   2e-09
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...    60   2e-09
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.              60   2e-09
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...    58   8e-09
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.       58   8e-09
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...    58   8e-09
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...    58   8e-09
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...    58   8e-09
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                 46   3e-05
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...    46   6e-05
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.        43   3e-04
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...    42   5e-04
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...    42   5e-04
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...    42   5e-04
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        41   0.001
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    41   0.001
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...    41   0.001
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      41   0.001
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               41   0.001
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              41   0.001
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...    41   0.001
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    41   0.001
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    40   0.002
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              40   0.002
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 40   0.002
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              40   0.002
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...    40   0.004
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...    40   0.004
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...    40   0.004
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...    40   0.004
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...    40   0.004
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               39   0.005
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        39   0.005
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         39   0.005
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        39   0.005
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         39   0.005
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    39   0.005
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               39   0.005
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    39   0.005
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.        39   0.007
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.        39   0.007
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...    39   0.007
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.      39   0.007
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    39   0.007
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    37   0.027
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    37   0.027
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    37   0.027
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    36   0.048
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    36   0.048
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    36   0.048
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    36   0.048
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    36   0.048
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    36   0.048
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    36   0.048
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    36   0.063
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    35   0.083
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    35   0.083
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    35   0.11 
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.15 
U27831-1|AAA87555.1|  537|Homo sapiens striatum-enriched phospha...    31   1.0  
BC064807-1|AAH64807.1|  565|Homo sapiens protein tyrosine phosph...    31   1.0  
BC046435-1|AAH46435.1|  201|Homo sapiens PTPN5 protein protein.        31   1.0  
BC039897-1|AAH39897.1|  596|Homo sapiens PTPN5 protein protein.        31   1.0  
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.        31   1.0  
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.        31   1.0  
AK090923-1|BAC03548.1|  565|Homo sapiens protein ( Homo sapiens ...    31   1.0  
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.    31   1.0  
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.            31   1.0  
U58837-1|AAB63387.1| 1251|Homo sapiens cGMP-gated cation channel...    31   1.8  
L15296-1|AAA65620.1|  909|Homo sapiens cyclic nucleotide-gated c...    31   1.8  
AF042498-1|AAC04830.1| 1245|Homo sapiens rod photoreceptor CNG-c...    31   1.8  
BC013882-1|AAH13882.2|  583|Homo sapiens EYA2 protein protein.         30   3.1  
X05344-1|CAA28955.1|  412|Homo sapiens cathepsin D protein.            29   5.5  
M63138-1|AAA51922.1|  412|Homo sapiens cathepsin D protein.            29   5.5  
M11233-1|AAB59529.1|  412|Homo sapiens CTSD protein.                   29   5.5  
CR456947-1|CAG33228.1|  412|Homo sapiens CTSD protein.                 29   5.5  
BT020155-1|AAV38957.1|  412|Homo sapiens cathepsin D (lysosomal ...    29   5.5  
BT006910-1|AAP35556.1|  412|Homo sapiens cathepsin D (lysosomal ...    29   5.5  
BC016320-1|AAH16320.1|  412|Homo sapiens cathepsin D protein.          29   5.5  
L07810-1|AAA02806.1|  126|Homo sapiens dynamin protein.                29   7.2  
L07809-1|AAA02805.1|  131|Homo sapiens dynamin protein.                29   7.2  
L07807-1|AAA02803.1|  864|Homo sapiens dynamin protein.                29   7.2  
BC111408-1|AAI11409.1|  373|Homo sapiens ZNF276 protein protein.       29   7.2  
BC110348-1|AAI10349.1|  539|Homo sapiens zinc finger protein 276...    29   7.2  
BC107603-1|AAI07604.1|  539|Homo sapiens zinc finger protein 276...    29   7.2  
BC105959-1|AAI05960.1|  398|Homo sapiens ZNF276 protein protein.       29   7.2  
BC101751-1|AAI01752.1|  535|Homo sapiens hypothetical protein LO...    29   7.2  
BC101749-1|AAI01750.1|  535|Homo sapiens hypothetical protein LO...    29   7.2  
BC063850-1|AAH63850.1|  851|Homo sapiens dynamin 1 protein.            29   7.2  
BC050279-1|AAH50279.2|  851|Homo sapiens dynamin 1 protein.            29   7.2  
BC032781-1|AAH32781.2|  532|Homo sapiens ZNF276 protein protein.       29   7.2  
AL590708-18|CAI13837.1|  864|Homo sapiens dynamin 1 protein.           29   7.2  
AL590708-17|CAI13839.2|  851|Homo sapiens dynamin 1 protein.           29   7.2  
AK125148-1|BAC86063.1|  191|Homo sapiens protein ( Homo sapiens ...    29   7.2  
AF354756-1|AAQ15129.1|  539|Homo sapiens zinc finger protein 276...    29   7.2  
AF354755-1|AAQ15128.1|  539|Homo sapiens zinc finger protein 276...    29   7.2  
U47677-1|AAC50719.1|  437|Homo sapiens transcription factor E2F1...    28   9.5  
S49592-1|AAB24289.1|  476|Homo sapiens transcription factor E2F ...    28   9.5  
M96577-1|AAA35782.1|  437|Homo sapiens E2F-1 protein.                  28   9.5  
BC058902-1|AAH58902.1|  437|Homo sapiens E2F transcription facto...    28   9.5  
BC050369-1|AAH50369.1|  437|Homo sapiens E2F transcription facto...    28   9.5  
BC024247-1|AAH24247.1|  502|Homo sapiens CDC2L6 protein protein.       28   9.5  
AL121906-7|CAC08486.1|  437|Homo sapiens E2F transcription facto...    28   9.5  
AF516106-1|AAM47604.1|  437|Homo sapiens E2F transcription facto...    28   9.5  
AF272899-1|AAF78079.1|  313|Homo sapiens PR-domain zinc finger p...    28   9.5  
AF272898-1|AAF78078.1|  608|Homo sapiens PR-domain zinc finger p...    28   9.5  

>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 26  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 72



 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 26/28 (92%), Positives = 26/28 (92%)
 Frame = +2

Query: 176 DNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRP 28


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 24  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 70



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 19/21 (90%), Positives = 19/21 (90%)
 Frame = +2

Query: 197 KAGFAGYDAPRAVFPSIVGSP 259
           KAGFAG DAPRAVFPSIVG P
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRP 26


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 21  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 67



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = +2

Query: 191 MCKAGFAGYDAPRAVFPSIVGSP 259
           MCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP 23


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 29  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 75



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 29/31 (93%), Positives = 29/31 (93%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           LVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 31


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  103 bits (248), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D+++AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE  ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 39


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCD-EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD EE  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE  ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 39


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCD-EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD EE  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE  ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 39


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE  ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 39


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE  ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 39


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE  ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 39


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCD-EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD EE  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE  ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 39


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/47 (93%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVG EAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGHEAQSKRGILTLKYPIEHGIITNWDDM 84



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDEEVA-ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MC+EE + ALV DNGSG+CKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRP 40


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score = 89.8 bits (213), Expect = 3e-18
 Identities = 40/42 (95%), Positives = 41/42 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIAT 375
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI T
Sbjct: 38  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIIT 79



 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 1/40 (2%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDE E  ALV DNGSG+ KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRP 40


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin
           protein.
          Length = 1075

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 38/47 (80%), Positives = 42/47 (89%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PR QG+M GM QK+SYVG EAQSKRGILTLKYP+EHGI TNWDDM
Sbjct: 736 GRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWDDM 782



 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 30/37 (81%), Positives = 33/37 (89%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D++ A LV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 702 DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 738


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+LT++YP+EHG+  +W+DM
Sbjct: 10  GRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDM 56


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+LT++YP+EHG+  +W+DM
Sbjct: 40  GRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+LT++YP+EHG+  +W+DM
Sbjct: 40  GRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+LT++YP+EHG+  +W+DM
Sbjct: 40  GRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+LT++YP+EHG+  +W+DM
Sbjct: 40  GRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+LT++YP+EHG+  +W+DM
Sbjct: 40  GRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+L+++YP+EHGI  +W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+L+++YP+EHGI  +W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+L+++YP+EHGI  +W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+L+++YP+EHGI  +W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 58.4 bits (135), Expect = 8e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+L+++YP+EHGI  +W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDM 86



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA   R +L + YP+E+GI  NWDDM
Sbjct: 53  KDLMVGDEASELRSMLEVNYPMENGIVRNWDDM 85



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V DNG+G  K G+AG + P  +FP++VG P IR+
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRS 43


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 19/33 (57%), Positives = 22/33 (66%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA   R  L + YP+E+GI  NWDDM
Sbjct: 53  KDLMVGDEASELRSTLEVNYPMENGIVRNWDDM 85



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V DNG+G  K G+AG + P  +FP++VG P IR+
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRS 43


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           VGDEA   R +L + YP+E+GI  NWDDM
Sbjct: 2   VGDEASELRSMLEVNYPMENGIVRNWDDM 30


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V A++ DNGSG+CKAG +G   PR V  S++G
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLG 40



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = +1

Query: 301 YVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           +VG EA  K   L L YPIE G+ T WDDM
Sbjct: 56  FVGQEALYKYEALHLHYPIERGLVTGWDDM 85


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V A++ DNGSG+CKAG +G   PR V  S++G
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLG 40



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = +1

Query: 301 YVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           +VG EA  K   L L YPIE G+ T WDDM
Sbjct: 56  FVGQEALYKYEALHLHYPIERGLVTGWDDM 85


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V A++ DNGSG+CKAG +G   PR V  S++G
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLG 40



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = +1

Query: 301 YVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           +VG EA  K   L L YPIE G+ T WDDM
Sbjct: 56  FVGQEALYKYEALHLHYPIERGLVTGWDDM 85


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V+DNGSGM KAG AG   P+ ++P+I+G
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIG 36



 Score = 35.1 bits (77), Expect = 0.083
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           VGD+AQ  R  L + YP+E G+ T+ +DM
Sbjct: 53  VGDQAQDWRSSLFISYPVERGLITSCEDM 81


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V+DNGSGM KAG AG   P+ ++P+I+G
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIG 36



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           VGD+AQ  R  L + YP+E G+ T+W+DM
Sbjct: 53  VGDQAQDWRSSLFISYPVERGLITSWEDM 81


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.
          Length = 426

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.
          Length = 426

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V+DNGSGM KAG AG   P+ ++P+I+G
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIG 36



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           VGD+AQ  R  L + YP+E G+ T+W+DM
Sbjct: 53  VGDQAQDWRSSLFISYPVERGLITSWEDM 81


>AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein
           hArpN alpha protein.
          Length = 426

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +1

Query: 220 CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           C +   S   G    + VM G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 34  CIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLM 89



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A VVD G+G  K G+AG   P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +1

Query: 220 CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           C +   S   G    + VM G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 34  CIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLM 89



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A VVD G+G  K G+AG   P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +1

Query: 220 CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           C +   S   G    + VM G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 34  CIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLM 89



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A VVD G+G  K G+AG   P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +1

Query: 220 CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           C +   S   G    + VM G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 34  CIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLM 89



 Score = 30.7 bits (66), Expect = 1.8
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A VVD G+G  K G+AG   P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           A++ DNGSG CKAG +G   PR +  SIVG
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVG 40



 Score = 34.3 bits (75), Expect = 0.15
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +1

Query: 301 YVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           +VG+EA  K+  L L  P E G+ T WDD+
Sbjct: 56  FVGEEALYKQEALQLHSPFERGLITGWDDV 85


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           A++ DNGSG CKAG +G   PR +  SIVG
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVG 40



 Score = 37.9 bits (84), Expect = 0.012
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G  + Q       QK  +VG+EA  K+  L L  P E G+ T WDD+
Sbjct: 40  GHLKFQAPSAEANQKKYFVGEEALYKQEALQLHSPFERGLITGWDDV 86


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           A++ DNGSG CKAG +G   PR +  SIVG
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVG 40



 Score = 37.9 bits (84), Expect = 0.012
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G  + Q       QK  +VG+EA  K+  L L  P E G+ T WDD+
Sbjct: 40  GHLKFQAPSAEANQKKYFVGEEALYKQEALQLHSPFERGLITGWDDV 86


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           A++ DNGSG CKAG +G   PR +  SIVG
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVG 40



 Score = 37.9 bits (84), Expect = 0.012
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G  + Q       QK  +VG+EA  K+  L L  P E G+ T WDD+
Sbjct: 40  GHLKFQAPSAEANQKKYFVGEEALYKQEALQLHSPFERGLITGWDDV 86


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           A++ DNGSG CKAG +G   PR +  SIVG
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVG 40



 Score = 37.9 bits (84), Expect = 0.012
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G  + Q       QK  +VG+EA  K+  L L  P E G+ T WDD+
Sbjct: 40  GHLKFQAPSAEANQKKYFVGEEALYKQEALQLHSPFERGLITGWDDV 86


>CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.
          Length = 429

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 15/28 (53%), Positives = 23/28 (82%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +++D+GSG  KAG AG++ P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 15/28 (53%), Positives = 23/28 (82%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +++D+GSG  KAG AG++ P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32777 fis, clone TESTI2002057, highly similar to
           Human actin-like peptide mRNA. ).
          Length = 366

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 15/28 (53%), Positives = 23/28 (82%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +++D+GSG  KAG AG++ P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.
          Length = 429

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein
           hArpN beta protein.
          Length = 429

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 226 SRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +  +S   GKP  +    G  +K+++VG E  +    L L  P+ HGI  +WD
Sbjct: 92  THKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWD 144



 Score = 36.7 bits (81), Expect = 0.027
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E   A+VVD G+G CK GFAG   P     + VG P
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKP 102


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 226 SRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +  +S   GKP  +    G  +K+++VG E  +    L L  P+ HGI  +WD
Sbjct: 92  THKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWD 144



 Score = 36.7 bits (81), Expect = 0.027
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E   A+VVD G+G CK GFAG   P     + VG P
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKP 102


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 226 SRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +  +S   GKP  +    G  +K+++VG E  +    L L  P+ HGI  +WD
Sbjct: 92  THKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWD 144



 Score = 36.7 bits (81), Expect = 0.027
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E   A+VVD G+G CK GFAG   P     + VG P
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKP 102


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 226 SRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +  +S   GKP  +    G  +K+++VG E  +    L L  P+ HGI  +WD
Sbjct: 92  THKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWD 144



 Score = 36.7 bits (81), Expect = 0.027
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E   A+VVD G+G CK GFAG   P     + VG P
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKP 102


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           VM G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 2   VMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLM 40


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 36.7 bits (81), Expect = 0.027
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           V+ G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 51  VLRGVDDLDFFIGDEAIDKPTYAT-KWPIRHGIIEDWDLM 89



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 170 VVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           VVD G+G  K G+AG   P+ + PS +
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 36.7 bits (81), Expect = 0.027
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           V+ G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 51  VLRGVDDLDFFIGDEAIDKPTYAT-KWPIRHGIIEDWDLM 89



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 170 VVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           VVD G+G  K G+AG   P+ + PS +
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 36.7 bits (81), Expect = 0.027
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           V+ G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 51  VLRGVDDLDFFIGDEAIDKPTYAT-KWPIRHGIIEDWDLM 89



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 170 VVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           VVD G+G  K G+AG   P+ + PS +
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 10
           homolog (S. cerevisiae) protein.
          Length = 417

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for
           IMAGE:3950510) protein.
          Length = 339

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized
           hypothalamus protein HARP11 variant protein.
          Length = 417

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized
           hypothalamus protein HARP11 variant protein.
          Length = 417

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12472 fis, clone NT2RM1000898, weakly similar to
           ACTIN, CYTOPLASMIC. ).
          Length = 417

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20537 fis, clone KAT11250. ).
          Length = 417

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized
           hypothalamus protein HARP11 protein.
          Length = 417

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1
           variant protein.
          Length = 429

 Score = 35.5 bits (78), Expect = 0.063
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV   GS   +AG+AG D P+  FP+ +G
Sbjct: 9   DEVGALVFYIGSYTVRAGYAGEDCPKVDFPTAIG 42


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +  A+V+D G+G CK GFAG  +P     +I+G
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILG 80


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +  A+V+D G+G CK GFAG  +P     +I+G
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILG 80


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           V+ G+   + ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 32  VLRGVDDLNFFIGDEAIDKPTYAT-KWPIRHGIIEDWDLM 70


>K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.
          Length = 17

 Score = 34.3 bits (75), Expect = 0.15
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMC 196
           D+++AALVVDNGSGMC
Sbjct: 2   DDDIAALVVDNGSGMC 17


>U27831-1|AAA87555.1|  537|Homo sapiens striatum-enriched
           phosphatase protein.
          Length = 537

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -2

Query: 256 ASHDRGKHCARSIISCEAGLAHTGAIV 176
           A+   G HCA  I+ C AG+  TG  +
Sbjct: 453 AAQQEGPHCAPIIVHCSAGIGRTGCFI 479


>BC064807-1|AAH64807.1|  565|Homo sapiens protein tyrosine
           phosphatase, non-receptor type 5 (striatum-enriched)
           protein.
          Length = 565

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -2

Query: 256 ASHDRGKHCARSIISCEAGLAHTGAIV 176
           A+   G HCA  I+ C AG+  TG  +
Sbjct: 481 AAQQEGPHCAPIIVHCSAGIGRTGCFI 507


>BC046435-1|AAH46435.1|  201|Homo sapiens PTPN5 protein protein.
          Length = 201

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -2

Query: 256 ASHDRGKHCARSIISCEAGLAHTGAIV 176
           A+   G HCA  I+ C AG+  TG  +
Sbjct: 117 AAQQEGPHCAPIIVHCSAGIGRTGCFI 143


>BC039897-1|AAH39897.1|  596|Homo sapiens PTPN5 protein protein.
          Length = 596

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -2

Query: 256 ASHDRGKHCARSIISCEAGLAHTGAIV 176
           A+   G HCA  I+ C AG+  TG  +
Sbjct: 512 AAQQEGPHCAPIIVHCSAGIGRTGCFI 538


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++ A+++D GS  CK G+AG   P     S VG
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVG 80



 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +1

Query: 235 VSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +S   GK   +    G  +K + VG E  +    L L  P++HGI  +WD
Sbjct: 75  ISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWD 124


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++ A+++D GS  CK G+AG   P     S VG
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVG 80



 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +1

Query: 235 VSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +S   GK   +    G  +K + VG E  +    L L  P++HGI  +WD
Sbjct: 75  ISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWD 124


>AK090923-1|BAC03548.1|  565|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33604 fis, clone BRAMY2015251, highly similar to
           PROTEIN-TYROSINE PHOSPHATASE STRIATUM-ENRICHED (EC
           3.1.3.48). ).
          Length = 565

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -2

Query: 256 ASHDRGKHCARSIISCEAGLAHTGAIV 176
           A+   G HCA  I+ C AG+  TG  +
Sbjct: 481 AAQQEGPHCAPIIVHCSAGIGRTGCFI 507


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++ A+++D GS  CK G+AG   P     S VG
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVG 80



 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +1

Query: 235 VSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +S   GK   +    G  +K + VG E  +    L L  P++HGI  +WD
Sbjct: 75  ISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWD 124


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++ A+++D GS  CK G+AG   P     S VG
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVG 80



 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +1

Query: 235 VSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +S   GK   +    G  +K + VG E  +    L L  P++HGI  +WD
Sbjct: 75  ISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWD 124


>U58837-1|AAB63387.1| 1251|Homo sapiens cGMP-gated cation channel
           beta subunit protein.
          Length = 1251

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
 Frame = -2

Query: 139 ELVKLVRCRCDKMKIK--RPAVTANREKQIPDCRPGAGTPAPGILPA 5
           ELVKL + R +K+K K   P VT++ E   P     A  PAP   PA
Sbjct: 570 ELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPAPDTKPA 616


>L15296-1|AAA65620.1|  909|Homo sapiens cyclic nucleotide-gated
           cation channel protein.
          Length = 909

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
 Frame = -2

Query: 139 ELVKLVRCRCDKMKIK--RPAVTANREKQIPDCRPGAGTPAPGILPA 5
           ELVKL + R +K+K K   P VT++ E   P     A  PAP   PA
Sbjct: 228 ELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPAPDTKPA 274


>AF042498-1|AAC04830.1| 1245|Homo sapiens rod photoreceptor
           CNG-channel beta subunit protein.
          Length = 1245

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
 Frame = -2

Query: 139 ELVKLVRCRCDKMKIK--RPAVTANREKQIPDCRPGAGTPAPGILPA 5
           ELVKL + R +K+K K   P VT++ E   P     A  PAP   PA
Sbjct: 564 ELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPAPDTKPA 610


>BC013882-1|AAH13882.2|  583|Homo sapiens EYA2 protein protein.
          Length = 583

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 21/60 (35%), Positives = 25/60 (41%)
 Frame = +3

Query: 192 CARPASQDMMLLAQCFPRSWEAPPSGRDGRYGTEGLLCRR*GTEQKRYPDPQIPHRTRNR 371
           C RP S    L A   PRS     +G +G  G      RR G   +R   P+ P R R R
Sbjct: 29  CVRPRSPASRLGAPTRPRSGAGTRAGAEGGPGPG----RRRGRSSRRRQQPRQPRRRRQR 84


>X05344-1|CAA28955.1|  412|Homo sapiens cathepsin D protein.
          Length = 412

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWDR 292
           +K+  E+    V   G  +C +GF G D P    P  I+G   I   ++V+DR
Sbjct: 347 YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDR 399


>M63138-1|AAA51922.1|  412|Homo sapiens cathepsin D protein.
          Length = 412

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWDR 292
           +K+  E+    V   G  +C +GF G D P    P  I+G   I   ++V+DR
Sbjct: 347 YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDR 399


>M11233-1|AAB59529.1|  412|Homo sapiens CTSD protein.
          Length = 412

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWDR 292
           +K+  E+    V   G  +C +GF G D P    P  I+G   I   ++V+DR
Sbjct: 347 YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDR 399


>CR456947-1|CAG33228.1|  412|Homo sapiens CTSD protein.
          Length = 412

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWDR 292
           +K+  E+    V   G  +C +GF G D P    P  I+G   I   ++V+DR
Sbjct: 347 YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDR 399


>BT020155-1|AAV38957.1|  412|Homo sapiens cathepsin D (lysosomal
           aspartyl protease) protein.
          Length = 412

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWDR 292
           +K+  E+    V   G  +C +GF G D P    P  I+G   I   ++V+DR
Sbjct: 347 YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDR 399


>BT006910-1|AAP35556.1|  412|Homo sapiens cathepsin D (lysosomal
           aspartyl protease) protein.
          Length = 412

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWDR 292
           +K+  E+    V   G  +C +GF G D P    P  I+G   I   ++V+DR
Sbjct: 347 YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDR 399


>BC016320-1|AAH16320.1|  412|Homo sapiens cathepsin D protein.
          Length = 412

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPS-IVGSPAIRA*WSVWDR 292
           +K+  E+    V   G  +C +GF G D P    P  I+G   I   ++V+DR
Sbjct: 347 YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDR 399


>L07810-1|AAA02806.1|  126|Homo sapiens dynamin protein.
          Length = 126

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPAG 2
           R   +P  RPG+  PAPG  PAG
Sbjct: 59  RAPAVPPARPGSRGPAPGPPPAG 81


>L07809-1|AAA02805.1|  131|Homo sapiens dynamin protein.
          Length = 131

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPAG 2
           R   +P  RPG+  PAPG  PAG
Sbjct: 59  RAPAVPPARPGSRGPAPGPPPAG 81


>L07807-1|AAA02803.1|  864|Homo sapiens dynamin protein.
          Length = 864

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPAG 2
           R   +P  RPG+  PAPG  PAG
Sbjct: 784 RAPAVPPARPGSRGPAPGPPPAG 806


>BC111408-1|AAI11409.1|  373|Homo sapiens ZNF276 protein protein.
          Length = 373

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 290 CPIPTITP*WRGFPRSRETLREEHHILRSRPCTY 189
           CP    T  +RG    ++ ++E H  +R RPC +
Sbjct: 195 CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPH 228


>BC110348-1|AAI10349.1|  539|Homo sapiens zinc finger protein 276
           protein.
          Length = 539

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 290 CPIPTITP*WRGFPRSRETLREEHHILRSRPCTY 189
           CP    T  +RG    ++ ++E H  +R RPC +
Sbjct: 361 CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPH 394


>BC107603-1|AAI07604.1|  539|Homo sapiens zinc finger protein 276
           protein.
          Length = 539

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 290 CPIPTITP*WRGFPRSRETLREEHHILRSRPCTY 189
           CP    T  +RG    ++ ++E H  +R RPC +
Sbjct: 361 CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPH 394


>BC105959-1|AAI05960.1|  398|Homo sapiens ZNF276 protein protein.
          Length = 398

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 290 CPIPTITP*WRGFPRSRETLREEHHILRSRPCTY 189
           CP    T  +RG    ++ ++E H  +R RPC +
Sbjct: 220 CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPH 253


>BC101751-1|AAI01752.1|  535|Homo sapiens hypothetical protein
           LOC162073 protein.
          Length = 535

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/61 (26%), Positives = 27/61 (44%)
 Frame = -3

Query: 321 LCLISYIRVLLSHTDHHALMAGLPTIEGNTARGASYPAKPALHIPEPLSTTNAATSSSHI 142
           L L+SY+ +   H      + G P +EG+ A  + +  +P L I       +    S H+
Sbjct: 56  LLLLSYVLLRCRHAVRQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHV 115

Query: 141 L 139
           L
Sbjct: 116 L 116


>BC101749-1|AAI01750.1|  535|Homo sapiens hypothetical protein
           LOC162073 protein.
          Length = 535

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/61 (26%), Positives = 27/61 (44%)
 Frame = -3

Query: 321 LCLISYIRVLLSHTDHHALMAGLPTIEGNTARGASYPAKPALHIPEPLSTTNAATSSSHI 142
           L L+SY+ +   H      + G P +EG+ A  + +  +P L I       +    S H+
Sbjct: 56  LLLLSYVLLRCRHAVRQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHV 115

Query: 141 L 139
           L
Sbjct: 116 L 116


>BC063850-1|AAH63850.1|  851|Homo sapiens dynamin 1 protein.
          Length = 851

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPAG 2
           R   +P  RPG+  PAPG  PAG
Sbjct: 784 RAPAVPPARPGSRGPAPGPPPAG 806


>BC050279-1|AAH50279.2|  851|Homo sapiens dynamin 1 protein.
          Length = 851

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPAG 2
           R   +P  RPG+  PAPG  PAG
Sbjct: 784 RAPAVPPARPGSRGPAPGPPPAG 806


>BC032781-1|AAH32781.2|  532|Homo sapiens ZNF276 protein protein.
          Length = 532

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 290 CPIPTITP*WRGFPRSRETLREEHHILRSRPCTY 189
           CP    T  +RG    ++ ++E H  +R RPC +
Sbjct: 354 CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPH 387


>AL590708-18|CAI13837.1|  864|Homo sapiens dynamin 1 protein.
          Length = 864

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPAG 2
           R   +P  RPG+  PAPG  PAG
Sbjct: 784 RAPAVPPARPGSRGPAPGPPPAG 806


>AL590708-17|CAI13839.2|  851|Homo sapiens dynamin 1 protein.
          Length = 851

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPAG 2
           R   +P  RPG+  PAPG  PAG
Sbjct: 784 RAPAVPPARPGSRGPAPGPPPAG 806


>AK125148-1|BAC86063.1|  191|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43158 fis, clone ERLTF2000324. ).
          Length = 191

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 24/76 (31%), Positives = 31/76 (40%), Gaps = 1/76 (1%)
 Frame = -2

Query: 370 RFRVR-WGI*GSGYLFCSVPHLLHKSPSVPYRPSRPDGGASHDRGKHCARSIISCEAGLA 194
           +FR R WG  G G   C    +  +        S P  G + +RG  CAR       GLA
Sbjct: 98  QFRARRWGCTGEGLALCQALGVHGRGAG-----SVPGAGGARERGWLCARRCGCTGEGLA 152

Query: 193 HTGAIVYYQRGNFFVA 146
              A+  + RG  F A
Sbjct: 153 LCQALGVHGRGAGFWA 168


>AF354756-1|AAQ15129.1|  539|Homo sapiens zinc finger protein 276
           protein.
          Length = 539

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 290 CPIPTITP*WRGFPRSRETLREEHHILRSRPCTY 189
           CP    T  +RG    ++ ++E H  +R RPC +
Sbjct: 361 CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPH 394


>AF354755-1|AAQ15128.1|  539|Homo sapiens zinc finger protein 276
           protein.
          Length = 539

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 290 CPIPTITP*WRGFPRSRETLREEHHILRSRPCTY 189
           CP    T  +RG    ++ ++E H  +R RPC +
Sbjct: 361 CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPH 394


>U47677-1|AAC50719.1|  437|Homo sapiens transcription factor E2F1
           protein.
          Length = 437

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSH 113
           GR PG GV +PG +S    S L +T  R + +LSH
Sbjct: 112 GRHPGKGVKSPGEKSRYETS-LNLTTKRFLELLSH 145


>S49592-1|AAB24289.1|  476|Homo sapiens transcription factor E2F
           like protein protein.
          Length = 476

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSH 113
           GR PG GV +PG +S    S L +T  R + +LSH
Sbjct: 151 GRHPGKGVKSPGEKSRYETS-LNLTTKRFLELLSH 184


>M96577-1|AAA35782.1|  437|Homo sapiens E2F-1 protein.
          Length = 437

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSH 113
           GR PG GV +PG +S    S L +T  R + +LSH
Sbjct: 112 GRHPGKGVKSPGEKSRYETS-LNLTTKRFLELLSH 145


>BC058902-1|AAH58902.1|  437|Homo sapiens E2F transcription factor 1
           protein.
          Length = 437

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSH 113
           GR PG GV +PG +S    S L +T  R + +LSH
Sbjct: 112 GRHPGKGVKSPGEKSRYETS-LNLTTKRFLELLSH 145


>BC050369-1|AAH50369.1|  437|Homo sapiens E2F transcription factor 1
           protein.
          Length = 437

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSH 113
           GR PG GV +PG +S    S L +T  R + +LSH
Sbjct: 112 GRHPGKGVKSPGEKSRYETS-LNLTTKRFLELLSH 145


>BC024247-1|AAH24247.1|  502|Homo sapiens CDC2L6 protein protein.
          Length = 502

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +1

Query: 145 VRRRSCRVGSRQWLRYVQGRLR 210
           VRRR+C VG+R W   + G LR
Sbjct: 7   VRRRACFVGARLWWPEIPGGLR 28


>AL121906-7|CAC08486.1|  437|Homo sapiens E2F transcription factor 1
           protein.
          Length = 437

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSH 113
           GR PG GV +PG +S    S L +T  R + +LSH
Sbjct: 112 GRHPGKGVKSPGEKSRYETS-LNLTTKRFLELLSH 145


>AF516106-1|AAM47604.1|  437|Homo sapiens E2F transcription factor 1
           protein.
          Length = 437

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSH 113
           GR PG GV +PG +S    S L +T  R + +LSH
Sbjct: 112 GRHPGKGVKSPGEKSRYETS-LNLTTKRFLELLSH 145


>AF272899-1|AAF78079.1|  313|Homo sapiens PR-domain zinc finger
           protein 6 isoform B protein.
          Length = 313

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +3

Query: 3   PAGRIPGAGVPAPGRQSGICFSRLAVTAG 89
           PAG++P  G   PGR SG      AV +G
Sbjct: 30  PAGKLPERGTKEPGRGSGQAQQPTAVESG 58


>AF272898-1|AAF78078.1|  608|Homo sapiens PR-domain zinc finger
           protein 6 isoform A protein.
          Length = 608

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +3

Query: 3   PAGRIPGAGVPAPGRQSGICFSRLAVTAG 89
           PAG++P  G   PGR SG      AV +G
Sbjct: 30  PAGKLPERGTKEPGRGSGQAQQPTAVESG 58


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,565,324
Number of Sequences: 237096
Number of extensions: 1579507
Number of successful extensions: 5048
Number of sequences better than 10.0: 172
Number of HSP's better than 10.0 without gapping: 4388
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5036
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2756025120
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).