SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-3702|AAF56388.3|  977|Drosophila melanogaster CG11819-P...    95   5e-20
X05279-1|CAA28890.2|  639|Drosophila melanogaster protein kinase...    60   1e-09
X05076-1|CAA28736.1|  639|Drosophila melanogaster protein ( Dros...    60   1e-09
AY095003-1|AAM11331.1|  679|Drosophila melanogaster GH03188p pro...    60   1e-09
AE013599-2373|AAF57932.1|  670|Drosophila melanogaster CG6622-PA...    60   1e-09
AE013599-2372|AAF57933.1|  679|Drosophila melanogaster CG6622-PB...    60   1e-09
J04845-1|AAA28817.1|  700|Drosophila melanogaster protein ( D.me...    59   4e-09
BT004495-1|AAO42659.1|  700|Drosophila melanogaster GH24781p pro...    59   4e-09
AE013599-2371|AAF57934.1|  700|Drosophila melanogaster CG6518-PA...    59   4e-09
BT011431-1|AAR99089.1| 1120|Drosophila melanogaster RH64806p pro...    56   4e-08
AE014296-1219|AAF50588.3| 1120|Drosophila melanogaster CG32381-P...    56   4e-08
M55048-1|AAA28925.1|  474|Drosophila melanogaster synaptotagmin ...    55   5e-08
BT015226-1|AAT94455.1|  401|Drosophila melanogaster RE32027p pro...    55   5e-08
BT004498-1|AAO42662.1|  472|Drosophila melanogaster GH14933p pro...    55   5e-08
AE014298-1485|AAF46620.2|  638|Drosophila melanogaster CG11556-P...    55   5e-08
AE014134-476|AAF51205.1|  474|Drosophila melanogaster CG3139-PA,...    55   5e-08
AE014134-475|AAN10415.1|  472|Drosophila melanogaster CG3139-PC,...    55   5e-08
AE014134-474|AAF51206.2|  472|Drosophila melanogaster CG3139-PB,...    55   5e-08
AE014134-2870|AAG22438.1|  494|Drosophila melanogaster CG5559-PA...    54   1e-07
BT011181-1|AAR88542.1|  327|Drosophila melanogaster RE44043p pro...    52   3e-07
AE014135-59|AAN06523.2|  327|Drosophila melanogaster CG2381-PB, ...    52   3e-07
AE014135-58|AAS64606.2|  283|Drosophila melanogaster CG2381-PF, ...    52   3e-07
AE014135-57|AAF59353.3|  416|Drosophila melanogaster CG2381-PG, ...    52   3e-07
AE014135-56|AAN06525.3|  416|Drosophila melanogaster CG2381-PE, ...    52   3e-07
AE014135-55|AAN06524.3|  416|Drosophila melanogaster CG2381-PC, ...    52   3e-07
AE014135-54|AAF59354.4|  416|Drosophila melanogaster CG2381-PA, ...    52   3e-07
AE014134-477|AAS64625.1|  251|Drosophila melanogaster CG3139-PD,...    50   2e-06
BT025922-1|ABG02166.1|  316|Drosophila melanogaster IP11216p pro...    49   3e-06
BT029263-1|ABK30900.1|  495|Drosophila melanogaster IP03351p pro...    48   5e-06
AE014296-2454|AAF49683.1|  602|Drosophila melanogaster CG3020-PA...    48   5e-06
AE013599-2763|AAO41353.2|  929|Drosophila melanogaster CG15078-P...    48   9e-06
AE013599-2762|ABI31105.1|  940|Drosophila melanogaster CG15078-P...    48   9e-06
AY119455-1|AAM50109.1|  163|Drosophila melanogaster GH01240p pro...    46   2e-05
AY069559-1|AAL39704.1| 1508|Drosophila melanogaster LD28927p pro...    46   2e-05
AF169141-1|AAF22962.1| 1752|Drosophila melanogaster UNC-13 protein.    46   2e-05
AE014135-148|AAN06592.1| 2871|Drosophila melanogaster CG2999-PA,...    46   2e-05
BT025937-1|ABG02181.1|  520|Drosophila melanogaster IP13955p pro...    46   3e-05
AY229971-1|AAP04482.1| 1517|Drosophila melanogaster bitesize iso...    46   3e-05
AY229970-1|AAP04481.1| 2645|Drosophila melanogaster bitesize iso...    46   3e-05
AY229969-1|AAP04480.1| 1102|Drosophila melanogaster bitesize iso...    46   3e-05
AE014297-1905|AAX52955.1| 1517|Drosophila melanogaster CG33555-P...    46   3e-05
AE014297-1904|AAX52954.1| 2645|Drosophila melanogaster CG33555-P...    46   3e-05
AE014297-1903|AAX52953.1| 1102|Drosophila melanogaster CG33555-P...    46   3e-05
AE014297-1902|AAX52952.1| 1357|Drosophila melanogaster CG33555-P...    46   3e-05
AE014135-150|AAN06593.1| 3183|Drosophila melanogaster CG2999-PB,...    45   7e-05
AE014135-149|AAF59405.4| 2874|Drosophila melanogaster CG2999-PC,...    45   7e-05
Y17922-1|CAA76942.1| 1724|Drosophila melanogaster UNC-13-B prote...    44   1e-04
Y17921-1|CAA76941.1| 1304|Drosophila melanogaster UNC-13 protein...    44   1e-04
AY071620-1|AAL49242.1|  474|Drosophila melanogaster RE67111p pro...    44   2e-04
AF181098-1|AAD53186.1|  474|Drosophila melanogaster synaptotagmi...    44   2e-04
AE014297-591|AAF54037.2|  474|Drosophila melanogaster CG10047-PA...    44   2e-04
AY129451-1|AAM76193.1|  787|Drosophila melanogaster RE01517p pro...    40   0.001
AE014298-1891|AAF48260.1|  787|Drosophila melanogaster CG10617-P...    40   0.001
AY061595-1|AAL29143.1|  834|Drosophila melanogaster SD04682p pro...    36   0.023
AJ278468-1|CAC42101.1| 1007|Drosophila melanogaster putative ubi...    36   0.023
AE014296-2927|AAS64973.1|  793|Drosophila melanogaster CG7555-PD...    36   0.023
AE014296-2926|AAN11695.1|  956|Drosophila melanogaster CG7555-PB...    36   0.023
AE014296-2925|AAN11694.1|  834|Drosophila melanogaster CG7555-PC...    36   0.023
AE014296-2924|AAF49328.2| 1007|Drosophila melanogaster CG7555-PA...    36   0.023
BT021410-1|AAX33558.1| 1061|Drosophila melanogaster LD06566p pro...    36   0.040
AF464851-1|AAM09646.1| 1061|Drosophila melanogaster Smad-ubiquit...    36   0.040
AF416571-1|AAL09691.1| 1061|Drosophila melanogaster ubiquitin-pr...    36   0.040
AF216521-1|AAF21125.1| 1061|Drosophila melanogaster E3 ubiquitin...    36   0.040
AE013599-2520|AAF57824.3| 1061|Drosophila melanogaster CG4943-PA...    36   0.040
AY051567-1|AAK92991.1|  358|Drosophila melanogaster GH21511p pro...    33   0.16 
AE014297-3569|AAF56313.1|  816|Drosophila melanogaster CG6643-PA...    33   0.16 
AE014297-3568|AAN14000.2|  849|Drosophila melanogaster CG6643-PB...    33   0.16 
BT011345-1|AAR96137.1|  283|Drosophila melanogaster RH30337p pro...    30   1.5  
AY122072-1|AAM52584.1|  586|Drosophila melanogaster AT15369p pro...    30   1.5  
AE014297-50|AAF52148.1|  586|Drosophila melanogaster CG9778-PA p...    30   1.5  
AE014297-4823|AAF57207.1| 1844|Drosophila melanogaster CG1976-PA...    29   2.6  
AF529180-1|AAO84908.1| 2898|Drosophila melanogaster extracellula...    28   8.1  
AF529179-1|AAO84907.1| 2776|Drosophila melanogaster extracellula...    28   8.1  
AF205357-1|AAG37995.1| 2174|Drosophila melanogaster extracellula...    28   8.1  
AE014297-4238|AAF56795.3| 2894|Drosophila melanogaster CG33103-P...    28   8.1  
AE014297-4237|AAF56794.3| 2772|Drosophila melanogaster CG33103-P...    28   8.1  

>AE014297-3702|AAF56388.3|  977|Drosophila melanogaster CG11819-PA
           protein.
          Length = 977

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 43/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query: 211 THATSYQSGG*RAS-GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS 387
           TH   Y++   +    + LNVE+++A +L+ KD NGLSDPFVT+YL SN SHRYN+SVK 
Sbjct: 163 THEEIYEAARLKEPPNVRLNVEIIKAENLMSKDSNGLSDPFVTLYLESNGSHRYNSSVKP 222

Query: 388 GTLNPVWEEHFSL 426
            TLNP+WEEHFSL
Sbjct: 223 ATLNPIWEEHFSL 235



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
 Frame = +2

Query: 137 DVGCEVGQ---HAMLSYVQEAFKIGNDKHTQLLTKAEAKEPP 253
           ++GCE  +   ++++ +VQ+AFKI N  H ++   A  KEPP
Sbjct: 136 NIGCENNEECTNSLVEFVQDAFKIPNATHEEIYEAARLKEPP 177


>X05279-1|CAA28890.2|  639|Drosophila melanogaster protein kinase C
           protein.
          Length = 639

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V++ E  +L+P DPNGLSDP+V + L+       +  T      LNPVW E  +  +
Sbjct: 181 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDL 240

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  + +EVWD+D
Sbjct: 241 KPEDKDRRILIEVWDWD 257


>X05076-1|CAA28736.1|  639|Drosophila melanogaster protein (
           Drosophila melanogastermRNA for protein kinase C (PKC).
           ).
          Length = 639

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V++ E  +L+P DPNGLSDP+V + L+       +  T      LNPVW E  +  +
Sbjct: 181 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDL 240

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  + +EVWD+D
Sbjct: 241 KPEDKDRRILIEVWDWD 257


>AY095003-1|AAM11331.1|  679|Drosophila melanogaster GH03188p
           protein.
          Length = 679

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V++ E  +L+P DPNGLSDP+V + L+       +  T      LNPVW E  +  +
Sbjct: 190 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDL 249

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  + +EVWD+D
Sbjct: 250 KPEDKDRRILIEVWDWD 266


>AE013599-2373|AAF57932.1|  670|Drosophila melanogaster CG6622-PA,
           isoform A protein.
          Length = 670

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V++ E  +L+P DPNGLSDP+V + L+       +  T      LNPVW E  +  +
Sbjct: 181 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDL 240

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  + +EVWD+D
Sbjct: 241 KPEDKDRRILIEVWDWD 257


>AE013599-2372|AAF57933.1|  679|Drosophila melanogaster CG6622-PB,
           isoform B protein.
          Length = 679

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V++ E  +L+P DPNGLSDP+V + L+       +  T      LNPVW E  +  +
Sbjct: 190 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDL 249

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  + +EVWD+D
Sbjct: 250 KPEDKDRRILIEVWDWD 266


>J04845-1|AAA28817.1|  700|Drosophila melanogaster protein (
           D.melanogaster proteinkinase C (dPKC53E) mRNA complete
           cds. ).
          Length = 700

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 2/79 (2%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFSL 426
           G  L V++ EA +L+P D NG SDP++ + +  + S R     K+    LNPV+ E F+ 
Sbjct: 205 GNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTF 264

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     +  L +EVWD+D
Sbjct: 265 ELQPQDRDKRLLIEVWDWD 283


>BT004495-1|AAO42659.1|  700|Drosophila melanogaster GH24781p
           protein.
          Length = 700

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 2/79 (2%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFSL 426
           G  L V++ EA +L+P D NG SDP++ + +  + S R     K+    LNPV+ E F+ 
Sbjct: 205 GNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTF 264

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     +  L +EVWD+D
Sbjct: 265 ELQPQDRDKRLLIEVWDWD 283


>AE013599-2371|AAF57934.1|  700|Drosophila melanogaster CG6518-PA
           protein.
          Length = 700

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 2/79 (2%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKS--GTLNPVWEEHFSL 426
           G  L V++ EA +L+P D NG SDP++ + +  + S R     K+    LNPV+ E F+ 
Sbjct: 205 GNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTF 264

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     +  L +EVWD+D
Sbjct: 265 ELQPQDRDKRLLIEVWDWD 283


>BT011431-1|AAR99089.1| 1120|Drosophila melanogaster RH64806p protein.
          Length = 1120

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 34/81 (41%), Positives = 46/81 (56%), Gaps = 7/81 (8%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY----NTSVKSGTLNPVWEE--HFS 423
            L VEV+ A D+VP DPNG SDPFV I L+      +     T+V   TLNPV++E   FS
Sbjct: 963  LCVEVLHARDVVPLDPNGFSDPFVVIELLPRRVFLHCMEQQTNVHKRTLNPVFDECFEFS 1022

Query: 424  LPMSGTVNEDS-LCLEVWDFD 483
            + +   + E + +C  V D D
Sbjct: 1023 VTLEQCLTEGAMICFTVMDHD 1043



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAETV 498
           TS+K  TL P W E F   +   +N D+  L++WD D    V
Sbjct: 199 TSIKPHTLTPKWNEKFKFDID-DINTDTFHLDIWDHDDESCV 239



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPF 330
           ++L+  V+EA  L  KD NG SDP+
Sbjct: 95  IVLSAVVIEADGLEAKDANGFSDPY 119


>AE014296-1219|AAF50588.3| 1120|Drosophila melanogaster CG32381-PA
            protein.
          Length = 1120

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 34/81 (41%), Positives = 46/81 (56%), Gaps = 7/81 (8%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY----NTSVKSGTLNPVWEE--HFS 423
            L VEV+ A D+VP DPNG SDPFV I L+      +     T+V   TLNPV++E   FS
Sbjct: 963  LCVEVLHARDVVPLDPNGFSDPFVVIELLPRRVFLHCMEQQTNVHKRTLNPVFDECFEFS 1022

Query: 424  LPMSGTVNEDS-LCLEVWDFD 483
            + +   + E + +C  V D D
Sbjct: 1023 VTLEQCLTEGAMICFTVMDHD 1043



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAETV 498
           TS+K  TL P W E F   +   +N D+  L++WD D    V
Sbjct: 199 TSIKPHTLTPKWNEKFKFDID-DINTDTFHLDIWDHDDESCV 239



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPF 330
           ++L+  V+EA  L  KD NG SDP+
Sbjct: 95  IVLSAVVIEADGLEAKDANGFSDPY 119


>M55048-1|AAA28925.1|  474|Drosophila melanogaster synaptotagmin p65
           protein.
          Length = 474

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L V V++A +L   D  G SDP+V +YL+ +   ++ T V   TL+PV+ E F   SLP 
Sbjct: 209 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPY 268

Query: 433 SGTVNEDSLCLEVWDFD 483
           +  +N+ +L   ++DFD
Sbjct: 269 ADAMNK-TLVFAIFDFD 284



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I +M N     +  TSVK  TLNP + E FS  + 
Sbjct: 342 LTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSVKKCTLNPYYNESFSFEVP 401

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + V D+D
Sbjct: 402 FEQMQKICLVVTVVDYD 418


>BT015226-1|AAT94455.1|  401|Drosophila melanogaster RE32027p
           protein.
          Length = 401

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V +  +L+  D NG SDPFV I L   ++ + ++ TSVK  TLNP++ E F    S
Sbjct: 276 LVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEAS 335

Query: 436 -GTVNEDSLCLEVWDFD 483
              +N++ L L VWD D
Sbjct: 336 PHDLNKEMLILTVWDKD 352


>BT004498-1|AAO42662.1|  472|Drosophila melanogaster GH14933p
           protein.
          Length = 472

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L V V++A +L   D  G SDP+V +YL+ +   ++ T V   TL+PV+ E F   SLP 
Sbjct: 207 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPY 266

Query: 433 SGTVNEDSLCLEVWDFD 483
           +  +N+ +L   ++DFD
Sbjct: 267 ADAMNK-TLVFAIFDFD 282



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V + +M N     +  TSVK  TLNP + E FS  + 
Sbjct: 340 LTVVILEAKNLKKMDVGGLSDPYVKVAIMQNGKRLKKKKTSVKKCTLNPYYNESFSFEVP 399

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + V D+D
Sbjct: 400 FEQMQKICLVVTVVDYD 416


>AE014298-1485|AAF46620.2|  638|Drosophila melanogaster CG11556-PA
           protein.
          Length = 638

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V +  +L+  D NG SDPFV I L   ++ + ++ TSVK  TLNP++ E F    S
Sbjct: 513 LVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEAS 572

Query: 436 -GTVNEDSLCLEVWDFD 483
              +N++ L L VWD D
Sbjct: 573 PHDLNKEMLILTVWDKD 589


>AE014134-476|AAF51205.1|  474|Drosophila melanogaster CG3139-PA,
           isoform A protein.
          Length = 474

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L V V++A +L   D  G SDP+V +YL+ +   ++ T V   TL+PV+ E F   SLP 
Sbjct: 209 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPY 268

Query: 433 SGTVNEDSLCLEVWDFD 483
           +  +N+ +L   ++DFD
Sbjct: 269 ADAMNK-TLVFAIFDFD 284



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I +M N     +  TS+K  TLNP + E FS  + 
Sbjct: 342 LTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVP 401

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + V D+D
Sbjct: 402 FEQIQKICLVVTVVDYD 418


>AE014134-475|AAN10415.1|  472|Drosophila melanogaster CG3139-PC,
           isoform C protein.
          Length = 472

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L V V++A +L   D  G SDP+V +YL+ +   ++ T V   TL+PV+ E F   SLP 
Sbjct: 207 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPY 266

Query: 433 SGTVNEDSLCLEVWDFD 483
           +  +N+ +L   ++DFD
Sbjct: 267 ADAMNK-TLVFAIFDFD 282



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I +M N     +  TS+K  TLNP + E FS  + 
Sbjct: 340 LTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVP 399

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + V D+D
Sbjct: 400 FEQIQKICLVVTVVDYD 416


>AE014134-474|AAF51206.2|  472|Drosophila melanogaster CG3139-PB,
           isoform B protein.
          Length = 472

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L V V++A +L   D  G SDP+V +YL+ +   ++ T V   TL+PV+ E F   SLP 
Sbjct: 207 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPY 266

Query: 433 SGTVNEDSLCLEVWDFD 483
           +  +N+ +L   ++DFD
Sbjct: 267 ADAMNK-TLVFAIFDFD 282



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I +M N     +  TS+K  TLNP + E FS  + 
Sbjct: 340 LTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVP 399

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + V D+D
Sbjct: 400 FEQIQKICLVVTVVDYD 416


>AE014134-2870|AAG22438.1|  494|Drosophila melanogaster CG5559-PA
           protein.
          Length = 494

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 24/78 (30%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           G +LNV ++EA +L P+  +G +DP+  + L+ +  + + T +   TLNPV++E F   +
Sbjct: 222 GGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEV 281

Query: 433 -SGTVNEDSLCLEVWDFD 483
            +G +++ ++ + ++DFD
Sbjct: 282 TAGVIDKRTVEILLYDFD 299



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 4/55 (7%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYN---TSVKSGTLNPVWEE 414
           L V +++A +L +  D    SDP+V + L+     +     T V+ GTLNPV+ E
Sbjct: 357 LMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNE 411


>BT011181-1|AAR88542.1|  327|Drosophila melanogaster RE44043p
           protein.
          Length = 327

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 223

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 224 Q-KLQSRVLHLHVFDYD 239


>AE014135-59|AAN06523.2|  327|Drosophila melanogaster CG2381-PB,
           isoform B protein.
          Length = 327

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 223

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 224 Q-KLQSRVLHLHVFDYD 239


>AE014135-58|AAS64606.2|  283|Drosophila melanogaster CG2381-PF,
           isoform F protein.
          Length = 283

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 31  LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 90

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 91  Q-KLQSRVLHLHVFDYD 106



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           S  +L + +++A +L  KD NG SDP+V ++L        +  T + + TLNPV+ E FS
Sbjct: 156 SNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS 215

Query: 424 LPMS-GTVNEDSLCLEVWDFD 483
             +    + E SL + V DFD
Sbjct: 216 FNVPWEKIRECSLDVMVMDFD 236


>AE014135-57|AAF59353.3|  416|Drosophila melanogaster CG2381-PG,
           isoform G protein.
          Length = 416

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 223

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 224 Q-KLQSRVLHLHVFDYD 239



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           S  +L + +++A +L  KD NG SDP+V ++L        +  T + + TLNPV+ E FS
Sbjct: 289 SNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS 348

Query: 424 LPMS-GTVNEDSLCLEVWDFD 483
             +    + E SL + V DFD
Sbjct: 349 FNVPWEKIRECSLDVMVMDFD 369


>AE014135-56|AAN06525.3|  416|Drosophila melanogaster CG2381-PE,
           isoform E protein.
          Length = 416

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 223

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 224 Q-KLQSRVLHLHVFDYD 239



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           S  +L + +++A +L  KD NG SDP+V ++L        +  T + + TLNPV+ E FS
Sbjct: 289 SNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS 348

Query: 424 LPMS-GTVNEDSLCLEVWDFD 483
             +    + E SL + V DFD
Sbjct: 349 FNVPWEKIRECSLDVMVMDFD 369


>AE014135-55|AAN06524.3|  416|Drosophila melanogaster CG2381-PC,
           isoform C protein.
          Length = 416

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 223

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 224 Q-KLQSRVLHLHVFDYD 239



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           S  +L + +++A +L  KD NG SDP+V ++L        +  T + + TLNPV+ E FS
Sbjct: 289 SNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS 348

Query: 424 LPMS-GTVNEDSLCLEVWDFD 483
             +    + E SL + V DFD
Sbjct: 349 FNVPWEKIRECSLDVMVMDFD 369


>AE014135-54|AAF59354.4|  416|Drosophila melanogaster CG2381-PA,
           isoform A protein.
          Length = 416

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L ++V++  +L  KD +G SDP+V + L+ +  HR  T +K  TLNP W E F     P+
Sbjct: 164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPI 223

Query: 433 SGTVNEDSLCLEVWDFD 483
              +    L L V+D+D
Sbjct: 224 Q-KLQSRVLHLHVFDYD 239



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           S  +L + +++A +L  KD NG SDP+V ++L        +  T + + TLNPV+ E FS
Sbjct: 289 SNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS 348

Query: 424 LPMS-GTVNEDSLCLEVWDFD 483
             +    + E SL + V DFD
Sbjct: 349 FNVPWEKIRECSLDVMVMDFD 369


>AE014134-477|AAS64625.1|  251|Drosophila melanogaster CG3139-PD,
           isoform D protein.
          Length = 251

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I +M N     +  TS+K  TLNP + E FS  + 
Sbjct: 119 LTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVP 178

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  L + V D+D
Sbjct: 179 FEQIQKICLVVTVVDYD 195



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 3/60 (5%)
 Frame = +1

Query: 313 GLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPMSGTVNEDSLCLEVWDFD 483
           G SDP+V +YL+ +   ++ T V   TL+PV+ E F   SLP +  +N+ +L   ++DFD
Sbjct: 3   GTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNK-TLVFAIFDFD 61


>BT025922-1|ABG02166.1|  316|Drosophila melanogaster IP11216p
           protein.
          Length = 316

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 27/76 (35%), Positives = 41/76 (53%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L L V +   +DLV  D NGLSDP+V   +     H+  T  +   LNPVW+E F +P+ 
Sbjct: 41  LQLRVHLKSGSDLVAMDKNGLSDPYVKFKVGGRLLHKSRTIHRD--LNPVWDEVFIVPIE 98

Query: 436 GTVNEDSLCLEVWDFD 483
                  + ++V+D+D
Sbjct: 99  DPF--QPIIVKVFDYD 112


>BT029263-1|ABK30900.1|  495|Drosophila melanogaster IP03351p
           protein.
          Length = 495

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN-SSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           L V ++EA +L P +  G  DP+V + L     S +  T +  G  NP +++HF  P+S 
Sbjct: 250 LTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSR 309

Query: 436 GTVNEDSLCLEVWDFD 483
             +    L L+V D+D
Sbjct: 310 DQLQGKELILQVLDYD 325



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 4/40 (10%)
 Frame = +1

Query: 316 LSDPFVTIYLMSNSSH--RYNTSV--KSGTLNPVWEEHFS 423
           L +P+V IYL+ N     +  TS+       NP+W E F+
Sbjct: 394 LQEPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFT 433


>AE014296-2454|AAF49683.1|  602|Drosophila melanogaster CG3020-PA
           protein.
          Length = 602

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN-SSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           L V ++EA +L P +  G  DP+V + L     S +  T +  G  NP +++HF  P+S 
Sbjct: 357 LTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSR 416

Query: 436 GTVNEDSLCLEVWDFD 483
             +    L L+V D+D
Sbjct: 417 DQLQGKELILQVLDYD 432



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 4/40 (10%)
 Frame = +1

Query: 316 LSDPFVTIYLMSNSSH--RYNTSV--KSGTLNPVWEEHFS 423
           L +P+V IYL+ N     +  TS+       NP+W E F+
Sbjct: 501 LQEPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFT 540


>AE013599-2763|AAO41353.2|  929|Drosophila melanogaster CG15078-PA,
           isoform A protein.
          Length = 929

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 26/74 (35%), Positives = 40/74 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V +   +DLV  D NGLSDP+V   +     H+  T  +   LNPVW+E F +P+   
Sbjct: 255 LRVHLKSGSDLVAMDKNGLSDPYVKFKVGGRLLHKSRTIHRD--LNPVWDEVFIVPIEDP 312

Query: 442 VNEDSLCLEVWDFD 483
                + ++V+D+D
Sbjct: 313 F--QPIIVKVFDYD 324


>AE013599-2762|ABI31105.1|  940|Drosophila melanogaster CG15078-PC,
           isoform C protein.
          Length = 940

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 26/74 (35%), Positives = 40/74 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V +   +DLV  D NGLSDP+V   +     H+  T  +   LNPVW+E F +P+   
Sbjct: 255 LRVHLKSGSDLVAMDKNGLSDPYVKFKVGGRLLHKSRTIHRD--LNPVWDEVFIVPIEDP 312

Query: 442 VNEDSLCLEVWDFD 483
                + ++V+D+D
Sbjct: 313 F--QPIIVKVFDYD 324


>AY119455-1|AAM50109.1|  163|Drosophila melanogaster GH01240p
           protein.
          Length = 163

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 3/60 (5%)
 Frame = +1

Query: 313 GLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPMSGTVNEDSLCLEVWDFD 483
           G SDP+V +YL+ +   ++ T V   TL+PV+ E F   SLP +  +N+ +L   ++DFD
Sbjct: 3   GTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNK-TLVFAIFDFD 61



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN 354
           L V ++EA +L   D  GLSDP+V I +M N
Sbjct: 119 LTVVILEAKNLKKMDVGGLSDPYVKIAIMQN 149


>AY069559-1|AAL39704.1| 1508|Drosophila melanogaster LD28927p
           protein.
          Length = 1508

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F       
Sbjct: 484 LTITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN- 539

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 540 -SSDRIKVRVWDED 552



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 1355 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFT 1414

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 1415 IG---NEEQL 1421


>AF169141-1|AAF22962.1| 1752|Drosophila melanogaster UNC-13 protein.
          Length = 1752

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F       
Sbjct: 726 LTITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN- 781

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 782 -SSDRIKVRVWDED 794



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 1599 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFT 1658

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 1659 IG---NEEQL 1665


>AE014135-148|AAN06592.1| 2871|Drosophila melanogaster CG2999-PA,
            isoform A protein.
          Length = 2871

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            L + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F       
Sbjct: 1847 LTITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN- 1902

Query: 442  VNEDSLCLEVWDFD 483
             + D + + VWD D
Sbjct: 1903 -SSDRIKVRVWDED 1915



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 2718 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFT 2777

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 2778 IG---NEEQL 2784


>BT025937-1|ABG02181.1|  520|Drosophila melanogaster IP13955p
           protein.
          Length = 520

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
           L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 199 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 258

Query: 427 PMSGTVNEDSLCLEVWDFD 483
           P+S ++   +L L VW  D
Sbjct: 259 PIS-SLESRTLWLTVWHSD 276


>AY229971-1|AAP04482.1| 1517|Drosophila melanogaster bitesize isoform
            3 protein.
          Length = 1517

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 1196 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 1255

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 1256 PIS-SLESRTLWLTVWHSD 1273


>AY229970-1|AAP04481.1| 2645|Drosophila melanogaster bitesize isoform
            2 protein.
          Length = 2645

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 2324 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 2383

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 2384 PIS-SLESRTLWLTVWHSD 2401


>AY229969-1|AAP04480.1| 1102|Drosophila melanogaster bitesize isoform
            1 protein.
          Length = 1102

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 781  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 840

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 841  PIS-SLESRTLWLTVWHSD 858


>AE014297-1905|AAX52955.1| 1517|Drosophila melanogaster CG33555-PD,
            isoform D protein.
          Length = 1517

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 1196 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 1255

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 1256 PIS-SLESRTLWLTVWHSD 1273


>AE014297-1904|AAX52954.1| 2645|Drosophila melanogaster CG33555-PC,
            isoform C protein.
          Length = 2645

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 2324 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 2383

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 2384 PIS-SLESRTLWLTVWHSD 2401


>AE014297-1903|AAX52953.1| 1102|Drosophila melanogaster CG33555-PB,
            isoform B protein.
          Length = 1102

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 781  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 840

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 841  PIS-SLESRTLWLTVWHSD 858


>AE014297-1902|AAX52952.1| 1357|Drosophila melanogaster CG33555-PA,
            isoform A protein.
          Length = 1357

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPN-GLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSL 426
            L V VV   DL   D     SDP+V +YL+ + S   +  T VK  TLNP+++E   F  
Sbjct: 1036 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT 1095

Query: 427  PMSGTVNEDSLCLEVWDFD 483
            P+S ++   +L L VW  D
Sbjct: 1096 PIS-SLESRTLWLTVWHSD 1113


>AE014135-150|AAN06593.1| 3183|Drosophila melanogaster CG2999-PB,
            isoform B protein.
          Length = 3183

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +1

Query: 268  VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
            + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F        +
Sbjct: 2161 ITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN--S 2215

Query: 448  EDSLCLEVWDFD 483
             D + + VWD D
Sbjct: 2216 SDRIKVRVWDED 2227



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 3030 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFT 3089

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 3090 IG---NEEQL 3096


>AE014135-149|AAF59405.4| 2874|Drosophila melanogaster CG2999-PC,
            isoform C protein.
          Length = 2874

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +1

Query: 268  VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
            + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F        +
Sbjct: 1852 ITVICAQGLIAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN--S 1906

Query: 448  EDSLCLEVWDFD 483
             D + + VWD D
Sbjct: 1907 SDRIKVRVWDED 1918



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 2721 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFT 2780

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 2781 IG---NEEQL 2787


>Y17922-1|CAA76942.1| 1724|Drosophila melanogaster UNC-13-B protein
           protein.
          Length = 1724

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F        +
Sbjct: 728 ITVICAQGLMAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN--S 782

Query: 448 EDSLCLEVWDFD 483
            D + + VWD D
Sbjct: 783 SDRIKVRVWDED 794



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 1597 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQKKKRKFATKSKSNNWSPKYNESFSFT 1656

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 1657 IG---NEEQL 1663


>Y17921-1|CAA76941.1| 1304|Drosophila melanogaster UNC-13 protein
           protein.
          Length = 1304

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           + V+ A  L+ KD +G SDP+VT+ +   S  +  T      LNPVW E F        +
Sbjct: 308 ITVICAQGLMAKDKSGTSDPYVTVQV---SKVKKRTRTMPQELNPVWNEKFHFECHN--S 362

Query: 448 EDSLCLEVWDFD 483
            D + + VWD D
Sbjct: 363 SDRIKVRVWDED 374



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
            +NV+VV A DL  + P+G+  PFV I L    +     ++ T  KS   +P + E FS  
Sbjct: 1177 VNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQKKKRKFATKSKSNNWSPKYNESFSFT 1236

Query: 430  MSGTVNEDSL 459
            +    NE+ L
Sbjct: 1237 IG---NEEQL 1243


>AY071620-1|AAL49242.1|  474|Drosophila melanogaster RE67111p
           protein.
          Length = 474

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           L V +++A +L   D  GL+DP+V IYL+ N     +  T VK  TL+PV+ E F+
Sbjct: 348 LTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFA 403



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           +DP+V + L+ +  H+  T V   T NPV++E F+
Sbjct: 230 TDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFT 264


>AF181098-1|AAD53186.1|  474|Drosophila melanogaster synaptotagmin
           IV protein.
          Length = 474

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           L V +++A +L   D  GL+DP+V IYL+ N     +  T VK  TL+PV+ E F+
Sbjct: 348 LTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFA 403



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           +DP+V + L+ +  H+  T V   T NPV++E F+
Sbjct: 230 TDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFT 264


>AE014297-591|AAF54037.2|  474|Drosophila melanogaster CG10047-PA
           protein.
          Length = 474

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           L V +++A +L   D  GL+DP+V IYL+ N     +  T VK  TL+PV+ E F+
Sbjct: 348 LTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFA 403



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           +DP+V + L+ +  H+  T V   T NPV++E F+
Sbjct: 230 TDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFT 264


>AY129451-1|AAM76193.1|  787|Drosophila melanogaster RE01517p
           protein.
          Length = 787

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLV-PKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           G+ L V V+EA  L+ P     L D FV IYL+ +      T V  GTL P + E F   
Sbjct: 500 GMELTVSVLEAKGLICPFSVESL-DTFVRIYLVPDHPGAMQTKVVKGTLTPSYNESFDFW 558

Query: 430 MSGTVNEDSLCLEVWDFDPAETV 498
           +       SL   ++   PA T+
Sbjct: 559 LHKRQARHSLWFHLYHNGPAHTL 581


>AE014298-1891|AAF48260.1|  787|Drosophila melanogaster CG10617-PA
           protein.
          Length = 787

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLV-PKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           G+ L V V+EA  L+ P     L D FV IYL+ +      T V  GTL P + E F   
Sbjct: 500 GMELTVSVLEAKGLICPFSVESL-DTFVRIYLVPDHPGAMQTKVVKGTLTPSYNESFDFW 558

Query: 430 MSGTVNEDSLCLEVWDFDPAETV 498
           +       SL   ++   PA T+
Sbjct: 559 LHKRQARHSLWFHLYHNGPAHTL 581


>AY061595-1|AAL29143.1|  834|Drosophila melanogaster SD04682p
           protein.
          Length = 834

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMS-NSSHRYN---TSVKSGTLNPVWEEHFSLP 429
           L + V+    L  KD  G SDP+V I L + N     +   T  K  TLNP W E F   
Sbjct: 72  LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFR 131

Query: 430 MSGTVNEDSLCLEVWD 477
           +    +E  L  +V+D
Sbjct: 132 VK--PSEHKLVFQVFD 145


>AJ278468-1|CAC42101.1| 1007|Drosophila melanogaster putative
           ubiquitin ligase protein.
          Length = 1007

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMS-NSSHRYN---TSVKSGTLNPVWEEHFSLP 429
           L + V+    L  KD  G SDP+V I L + N     +   T  K  TLNP W E F   
Sbjct: 72  LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFR 131

Query: 430 MSGTVNEDSLCLEVWD 477
           +    +E  L  +V+D
Sbjct: 132 VK--PSEHKLVFQVFD 145


>AE014296-2927|AAS64973.1|  793|Drosophila melanogaster CG7555-PD,
           isoform D protein.
          Length = 793

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMS-NSSHRYN---TSVKSGTLNPVWEEHFSLP 429
           L + V+    L  KD  G SDP+V I L + N     +   T  K  TLNP W E F   
Sbjct: 34  LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFR 93

Query: 430 MSGTVNEDSLCLEVWD 477
           +    +E  L  +V+D
Sbjct: 94  VK--PSEHKLVFQVFD 107


>AE014296-2926|AAN11695.1|  956|Drosophila melanogaster CG7555-PB,
           isoform B protein.
          Length = 956

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMS-NSSHRYN---TSVKSGTLNPVWEEHFSLP 429
           L + V+    L  KD  G SDP+V I L + N     +   T  K  TLNP W E F   
Sbjct: 34  LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFR 93

Query: 430 MSGTVNEDSLCLEVWD 477
           +    +E  L  +V+D
Sbjct: 94  VK--PSEHKLVFQVFD 107


>AE014296-2925|AAN11694.1|  834|Drosophila melanogaster CG7555-PC,
           isoform C protein.
          Length = 834

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMS-NSSHRYN---TSVKSGTLNPVWEEHFSLP 429
           L + V+    L  KD  G SDP+V I L + N     +   T  K  TLNP W E F   
Sbjct: 72  LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFR 131

Query: 430 MSGTVNEDSLCLEVWD 477
           +    +E  L  +V+D
Sbjct: 132 VK--PSEHKLVFQVFD 145


>AE014296-2924|AAF49328.2| 1007|Drosophila melanogaster CG7555-PA,
           isoform A protein.
          Length = 1007

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMS-NSSHRYN---TSVKSGTLNPVWEEHFSLP 429
           L + V+    L  KD  G SDP+V I L + N     +   T  K  TLNP W E F   
Sbjct: 72  LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFR 131

Query: 430 MSGTVNEDSLCLEVWD 477
           +    +E  L  +V+D
Sbjct: 132 VK--PSEHKLVFQVFD 145


>BT021410-1|AAX33558.1| 1061|Drosophila melanogaster LD06566p
           protein.
          Length = 1061

 Score = 35.5 bits (78), Expect = 0.040
 Identities = 18/72 (25%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + ++ A +L  KD   L DPF  + +   +   Y+T +   +L+P W  H+ L +   
Sbjct: 15  VRITILCARNLARKDLFRLPDPFAKVQV-DGTGQVYSTEISKSSLDPKWNAHYDLFLG-- 71

Query: 442 VNEDSLCLEVWD 477
              D++ + VW+
Sbjct: 72  -IGDAITITVWN 82


>AF464851-1|AAM09646.1| 1061|Drosophila melanogaster Smad-ubiquitin
           E3 ligase Smurf1 protein.
          Length = 1061

 Score = 35.5 bits (78), Expect = 0.040
 Identities = 18/72 (25%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + ++ A +L  KD   L DPF  + +   +   Y+T +   +L+P W  H+ L +   
Sbjct: 15  VRITILCARNLARKDLFRLPDPFAKVQV-DGTGQVYSTEISKSSLDPKWNAHYDLFLG-- 71

Query: 442 VNEDSLCLEVWD 477
              D++ + VW+
Sbjct: 72  -IGDAITITVWN 82


>AF416571-1|AAL09691.1| 1061|Drosophila melanogaster
           ubiquitin-protein ligase protein.
          Length = 1061

 Score = 35.5 bits (78), Expect = 0.040
 Identities = 18/72 (25%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + ++ A +L  KD   L DPF  + +   +   Y+T +   +L+P W  H+ L +   
Sbjct: 15  VRITILCARNLARKDLFRLPDPFAKVQV-DGTGQVYSTEISKSSLDPKWNAHYDLFLG-- 71

Query: 442 VNEDSLCLEVWD 477
              D++ + VW+
Sbjct: 72  -IGDAITITVWN 82


>AF216521-1|AAF21125.1| 1061|Drosophila melanogaster E3 ubiquitin
           ligase protein.
          Length = 1061

 Score = 35.5 bits (78), Expect = 0.040
 Identities = 18/72 (25%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + ++ A +L  KD   L DPF  + +   +   Y+T +   +L+P W  H+ L +   
Sbjct: 15  VRITILCARNLARKDLFRLPDPFAKVQV-DGTGQVYSTEISKSSLDPKWNAHYDLFLG-- 71

Query: 442 VNEDSLCLEVWD 477
              D++ + VW+
Sbjct: 72  -IGDAITITVWN 82


>AE013599-2520|AAF57824.3| 1061|Drosophila melanogaster CG4943-PA
           protein.
          Length = 1061

 Score = 35.5 bits (78), Expect = 0.040
 Identities = 18/72 (25%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + ++ A +L  KD   L DPF  + +   +   Y+T +   +L+P W  H+ L +   
Sbjct: 15  VRITILCARNLARKDLFRLPDPFAKVQV-DGTGQVYSTEISKSSLDPKWNAHYDLFLG-- 71

Query: 442 VNEDSLCLEVWD 477
              D++ + VW+
Sbjct: 72  -IGDAITITVWN 82


>AY051567-1|AAK92991.1|  358|Drosophila melanogaster GH21511p
           protein.
          Length = 358

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+V + +   +  +DP+ + DP+V +YL+       +  TSV     NPV++  F   +S
Sbjct: 241 LDVTIHKIQKIPLRDPSNIPDPYVKLYLLPGRTKESKRKTSVIKDNCNPVYDASFEYLIS 300



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 20/76 (26%), Positives = 39/76 (51%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S  +L+V +  A  L     +   DP++   + S +  +  T++     +PVWE+ F+  
Sbjct: 2   SSAVLSVFIDSARHLKQARSSSKPDPYL---VCSVNKQKQQTAMIMRDDSPVWEQGFTFL 58

Query: 430 MSGTVNEDSLCLEVWD 477
           +S   NE SL ++++D
Sbjct: 59  VSNPDNE-SLNIKIYD 73


>AE014297-3569|AAF56313.1|  816|Drosophila melanogaster CG6643-PA,
           isoform A protein.
          Length = 816

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+V + +   +  +DP+ + DP+V +YL+       +  TSV     NPV++  F   +S
Sbjct: 699 LDVTIHKIQKIPLRDPSNIPDPYVKLYLLPGRTKESKRKTSVIKDNCNPVYDASFEYLIS 758



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 20/76 (26%), Positives = 39/76 (51%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S  +L+V +  A  L     +   DP++   + S +  +  T++     +PVWE+ F+  
Sbjct: 460 SSAVLSVFIDSARHLKQARSSSKPDPYL---VCSVNKQKQQTAMIMRDDSPVWEQGFTFL 516

Query: 430 MSGTVNEDSLCLEVWD 477
           +S   NE SL ++++D
Sbjct: 517 VSNPDNE-SLNIKIYD 531


>AE014297-3568|AAN14000.2|  849|Drosophila melanogaster CG6643-PB,
           isoform B protein.
          Length = 849

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+V + +   +  +DP+ + DP+V +YL+       +  TSV     NPV++  F   +S
Sbjct: 732 LDVTIHKIQKIPLRDPSNIPDPYVKLYLLPGRTKESKRKTSVIKDNCNPVYDASFEYLIS 791



 Score = 28.3 bits (60), Expect = 6.1
 Identities = 20/76 (26%), Positives = 39/76 (51%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S  +L+V +  A  L     +   DP++   + S +  +  T++     +PVWE+ F+  
Sbjct: 493 SSAVLSVFIDSARHLKQARSSSKPDPYL---VCSVNKQKQQTAMIMRDDSPVWEQGFTFL 549

Query: 430 MSGTVNEDSLCLEVWD 477
           +S   NE SL ++++D
Sbjct: 550 VSNPDNE-SLNIKIYD 564


>BT011345-1|AAR96137.1|  283|Drosophila melanogaster RH30337p
           protein.
          Length = 283

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 18/75 (24%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH---RYNTSVKSGTLNPVWEEHFSLPM 432
           L+VE+++ +       N   D +V + ++S+      R  TS++ G  NP+++E F+  +
Sbjct: 159 LSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQV 218

Query: 433 S-GTVNEDSLCLEVW 474
           +   +N+ +L + V+
Sbjct: 219 ALFQLNDVTLMISVY 233


>AY122072-1|AAM52584.1|  586|Drosophila melanogaster AT15369p
           protein.
          Length = 586

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 18/75 (24%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH---RYNTSVKSGTLNPVWEEHFSLPM 432
           L+VE+++ +       N   D +V + ++S+      R  TS++ G  NP+++E F+  +
Sbjct: 462 LSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQV 521

Query: 433 S-GTVNEDSLCLEVW 474
           +   +N+ +L + V+
Sbjct: 522 ALFQLNDVTLMISVY 536


>AE014297-50|AAF52148.1|  586|Drosophila melanogaster CG9778-PA
           protein.
          Length = 586

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 18/75 (24%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH---RYNTSVKSGTLNPVWEEHFSLPM 432
           L+VE+++ +       N   D +V + ++S+      R  TS++ G  NP+++E F+  +
Sbjct: 462 LSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQV 521

Query: 433 S-GTVNEDSLCLEVW 474
           +   +N+ +L + V+
Sbjct: 522 ALFQLNDVTLMISVY 536


>AE014297-4823|AAF57207.1| 1844|Drosophila melanogaster CG1976-PA
           protein.
          Length = 1844

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +1

Query: 361 HRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDP 486
           H+  T V+SG L   W+E F L + G    D L   V+ +DP
Sbjct: 818 HKARTVVRSGDLQFDWDESFELDLVGNKQLDVL---VYSWDP 856


>AF529180-1|AAO84908.1| 2898|Drosophila melanogaster extracellular
            matrix protein papilin3 protein.
          Length = 2898

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -1

Query: 189  ASCTYDSIACCPTSQPTSHPP 127
            + CT +   CCP SQ  +H P
Sbjct: 1427 SGCTRERFGCCPDSQTPAHGP 1447


>AF529179-1|AAO84907.1| 2776|Drosophila melanogaster extracellular
            matrix protein papilin2 protein.
          Length = 2776

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -1

Query: 189  ASCTYDSIACCPTSQPTSHPP 127
            + CT +   CCP SQ  +H P
Sbjct: 1427 SGCTRERFGCCPDSQTPAHGP 1447


>AF205357-1|AAG37995.1| 2174|Drosophila melanogaster extracellular
            matrix protein papilinprotein.
          Length = 2174

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -1

Query: 189  ASCTYDSIACCPTSQPTSHPP 127
            + CT +   CCP SQ  +H P
Sbjct: 1427 SGCTRERFGCCPDSQTPAHGP 1447


>AE014297-4238|AAF56795.3| 2894|Drosophila melanogaster CG33103-PA,
            isoform A protein.
          Length = 2894

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -1

Query: 189  ASCTYDSIACCPTSQPTSHPP 127
            + CT +   CCP SQ  +H P
Sbjct: 1427 SGCTRERFGCCPDSQTPAHGP 1447


>AE014297-4237|AAF56794.3| 2772|Drosophila melanogaster CG33103-PB,
            isoform B protein.
          Length = 2772

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -1

Query: 189  ASCTYDSIACCPTSQPTSHPP 127
            + CT +   CCP SQ  +H P
Sbjct: 1427 SGCTRERFGCCPDSQTPAHGP 1447


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,157,040
Number of Sequences: 53049
Number of extensions: 467985
Number of successful extensions: 1320
Number of sequences better than 10.0: 76
Number of HSP's better than 10.0 without gapping: 1195
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1290
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1763278080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).