SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X56432-1|CAA39817.1|  509|Drosophila melanogaster runt product p...    36   0.073
BT029257-1|ABK30894.1|  510|Drosophila melanogaster FI01105p pro...    36   0.073
AY121615-1|AAM51942.2|  507|Drosophila melanogaster GH02614p pro...    36   0.073
AF077080-1|AAC27786.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077079-1|AAC27785.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077078-1|AAC27784.1|  507|Drosophila melanogaster runt protein.      36   0.073
AF077077-1|AAC27783.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077076-1|AAC27782.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077075-1|AAC27781.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077074-1|AAC27780.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077073-1|AAC27779.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077072-1|AAC27778.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077071-1|AAC27777.1|  510|Drosophila melanogaster runt protein.      36   0.073
AF077070-1|AAC27776.1|  510|Drosophila melanogaster runt protein.      36   0.073
AE014298-3046|AAF50886.1|  510|Drosophila melanogaster CG1849-PA...    36   0.073
BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p pro...    29   4.8  
AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-P...    29   4.8  
AY119196-1|AAM51056.1|  504|Drosophila melanogaster SD12535p pro...    29   6.4  
AY070678-1|AAL48149.1|  504|Drosophila melanogaster RH16046p pro...    29   6.4  
AE013599-1978|AAF58186.1|  504|Drosophila melanogaster CG10247-P...    29   6.4  
AE013599-1976|AAF58188.1|  462|Drosophila melanogaster CG10246-P...    29   6.4  

>X56432-1|CAA39817.1|  509|Drosophila melanogaster runt product
           protein.
          Length = 509

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 65  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 122

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 123 PSILCSALPNHWRSNKSLPGAFKVI 147


>BT029257-1|ABK30894.1|  510|Drosophila melanogaster FI01105p
           protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AY121615-1|AAM51942.2|  507|Drosophila melanogaster GH02614p
           protein.
          Length = 507

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077080-1|AAC27786.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077079-1|AAC27785.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077078-1|AAC27784.1|  507|Drosophila melanogaster runt protein.
          Length = 507

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077077-1|AAC27783.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077076-1|AAC27782.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077075-1|AAC27781.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077074-1|AAC27780.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077073-1|AAC27779.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077072-1|AAC27778.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077071-1|AAC27777.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AF077070-1|AAC27776.1|  510|Drosophila melanogaster runt protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>AE014298-3046|AAF50886.1|  510|Drosophila melanogaster CG1849-PA
           protein.
          Length = 510

 Score = 35.5 bits (78), Expect = 0.073
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = -3

Query: 715 SNVGGSLDDIFTVRTRAVSNRFRTSNFRS*LMKTPLANAFADVRLATIQEFHL*RRNTNA 536
           S+ G S  D+ T  T + SN   TS   S  M + + + FA +    +QE+H     T +
Sbjct: 66  SSTGSSTPDLSTNNTSSSSNA-TTSPQNSAKMPSSMTDMFASLH-EMLQEYHGELAQTGS 123

Query: 535 PSYPY*SLPGVLKTNKIEPRSYSII 461
           PS    +LP   ++NK  P ++ +I
Sbjct: 124 PSILCSALPNHWRSNKSLPGAFKVI 148


>BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p
           protein.
          Length = 2286

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
 Frame = -1

Query: 222 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NI*SVL 121
           R+ FS  +  WNY  CW   C   P+  R N+  +L
Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362


>AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-PA
           protein.
          Length = 2286

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
 Frame = -1

Query: 222 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NI*SVL 121
           R+ FS  +  WNY  CW   C   P+  R N+  +L
Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362


>AY119196-1|AAM51056.1|  504|Drosophila melanogaster SD12535p
           protein.
          Length = 504

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = -1

Query: 327 FRTPAHRRYVRKR---VSITADAVHRQPAHKCNYELFNRNNFS 208
           +  P H +YV K+   V I   A+HR      N   FN +NFS
Sbjct: 385 YEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFS 427


>AY070678-1|AAL48149.1|  504|Drosophila melanogaster RH16046p
           protein.
          Length = 504

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = -1

Query: 327 FRTPAHRRYVRKR---VSITADAVHRQPAHKCNYELFNRNNFS 208
           +  P H +YV K+   V I   A+HR      N   FN +NFS
Sbjct: 385 YEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFS 427


>AE013599-1978|AAF58186.1|  504|Drosophila melanogaster CG10247-PA
           protein.
          Length = 504

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = -1

Query: 327 FRTPAHRRYVRKR---VSITADAVHRQPAHKCNYELFNRNNFS 208
           +  P H +YV K+   V I   A+HR      N   FN +NFS
Sbjct: 385 YEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFS 427


>AE013599-1976|AAF58188.1|  462|Drosophila melanogaster CG10246-PA
           protein.
          Length = 462

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
 Frame = -1

Query: 327 FRTPAHRRYVRKR---VSITADAVHRQPAHKCNYELFNRNNFS 208
           +  P H +YV K+   V I   A+HR      N   FN +NFS
Sbjct: 343 YEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFS 385


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,711,883
Number of Sequences: 53049
Number of extensions: 650811
Number of successful extensions: 1369
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1309
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1369
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3211306956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).