SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT001711-1|AAN71466.1|  182|Drosophila melanogaster RE67695p pro...    38   0.017
AE014296-1719|AAN11954.1|  182|Drosophila melanogaster CG16707-P...    38   0.017
AE014296-1718|AAN11953.1|  182|Drosophila melanogaster CG16707-P...    38   0.017
AE014296-1717|AAN11952.1|  183|Drosophila melanogaster CG16707-P...    38   0.017
AE014296-1716|AAF50218.1|  183|Drosophila melanogaster CG16707-P...    38   0.017
AL031027-6|CAB41537.1|  352|Drosophila melanogaster EG:80H7.11 p...    34   0.28 
AY089578-1|AAL90316.1|  325|Drosophila melanogaster RE11134p pro...    33   0.49 
AF461100-1|AAL66368.1| 1179|Drosophila melanogaster dystroglycan...    33   0.49 
AE014298-221|AAF45636.1|  325|Drosophila melanogaster CG14781-PA...    33   0.49 
AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-P...    33   0.49 
AE013599-2171|AAO41377.2| 1179|Drosophila melanogaster CG18250-P...    33   0.49 
AY864367-1|AAX38005.1|  574|Drosophila melanogaster scavenger re...    31   1.5  
AE014298-611|AAF45929.2|  483|Drosophila melanogaster CG32774-PA...    31   1.5  
AE014297-1476|AAF54775.1|  588|Drosophila melanogaster CG4066-PA...    31   2.0  
S61744-1|AAB26699.1|  394|Drosophila melanogaster omb protein.         31   2.6  
S61735-1|AAB26698.1|  326|Drosophila melanogaster omb protein.         31   2.6  
S61732-1|AAB26697.1|  447|Drosophila melanogaster omb protein.         31   2.6  
M81796-1|AAA28736.1|  974|Drosophila melanogaster optomotor-blin...    31   2.6  
AE014298-1399|AAF46544.1| 4498|Drosophila melanogaster CG2989-PA...    31   2.6  
AE014298-631|AAF45946.2|  972|Drosophila melanogaster CG3578-PA ...    31   2.6  
AY060705-1|AAL28253.1|  167|Drosophila melanogaster GH14622p pro...    29   6.0  
AE014298-1577|AAF48013.1|  167|Drosophila melanogaster CG1394-PA...    29   6.0  
AE014296-1899|AAF50100.2|  150|Drosophila melanogaster CG32071-P...    29   6.0  
AE014134-2885|AAF53636.3| 1912|Drosophila melanogaster CG7527-PA...    29   6.0  
AE014134-2884|ABI31322.1| 1839|Drosophila melanogaster CG7527-PB...    29   6.0  
AE014134-2883|AAZ66476.1| 3101|Drosophila melanogaster CG7100-PL...    29   6.0  
AE014134-2882|AAZ66475.1| 3100|Drosophila melanogaster CG7100-PK...    29   6.0  
AE014134-2881|AAZ66474.1| 3100|Drosophila melanogaster CG7100-PI...    29   6.0  
AE014134-2880|AAZ66473.1| 3099|Drosophila melanogaster CG7100-PJ...    29   6.0  
AE014134-2879|AAN10998.1| 3097|Drosophila melanogaster CG7100-PE...    29   6.0  
AE014134-2878|AAN10997.1| 3096|Drosophila melanogaster CG7100-PG...    29   6.0  
AE014134-2877|AAN10996.1| 3096|Drosophila melanogaster CG7100-PA...    29   6.0  
AE014134-2876|AAN10995.1| 3095|Drosophila melanogaster CG7100-PC...    29   6.0  
AE014134-2875|AAF53635.1| 3097|Drosophila melanogaster CG7100-PD...    29   6.0  
AE014134-2874|AAN10994.1| 3096|Drosophila melanogaster CG7100-PF...    29   6.0  
AE014134-2873|AAN10993.1| 3096|Drosophila melanogaster CG7100-PB...    29   6.0  
AE014134-2872|AAN10992.1| 3095|Drosophila melanogaster CG7100-PH...    29   6.0  
AB002397-1|BAA22151.1| 3097|Drosophila melanogaster DN-cadherin ...    29   6.0  
DQ831954-1|ABJ09069.1| 1223|Drosophila melanogaster SnoN protein.      29   7.9  
DQ831953-1|ABJ09068.1| 1223|Drosophila melanogaster SnoN protein.      29   7.9  
DQ831952-1|ABJ09067.1| 1223|Drosophila melanogaster SnoN protein.      29   7.9  
DQ138812-1|ABA86418.1|  866|Drosophila melanogaster CG7093 protein.    29   7.9  
BT011354-1|AAR96146.1|  492|Drosophila melanogaster RE71830p pro...    29   7.9  
BT001719-1|AAN71474.1|  655|Drosophila melanogaster RE68846p pro...    29   7.9  
AY113304-1|AAM29309.1|  818|Drosophila melanogaster AT27185p pro...    29   7.9  
AY071657-1|AAL49279.1|  208|Drosophila melanogaster RE73905p pro...    29   7.9  
AY058699-1|AAL13928.1|  600|Drosophila melanogaster LD42024p pro...    29   7.9  
AM282581-1|CAK54357.1| 1011|Drosophila melanogaster dSki protein...    29   7.9  
AE014298-3195|AAF50943.2|  208|Drosophila melanogaster CG17600-P...    29   7.9  
AE014298-3192|AAF50946.2|  600|Drosophila melanogaster CG17600-P...    29   7.9  
AE014134-1364|AAF52579.2|  887|Drosophila melanogaster CG7093-PA...    29   7.9  
AE013599-482|AAF59206.3|  655|Drosophila melanogaster CG1399-PA,...    29   7.9  
AE013599-481|AAF59205.2| 1399|Drosophila melanogaster CG1399-PB,...    29   7.9  

>BT001711-1|AAN71466.1|  182|Drosophila melanogaster RE67695p
           protein.
          Length = 182

 Score = 37.9 bits (84), Expect = 0.017
 Identities = 25/71 (35%), Positives = 33/71 (46%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  S TS  T  T T+  IT+     + ST    +S+ + T   S    T  +TTT  PG
Sbjct: 54  PSTSTTSTTTEKTTTTPPITTSTEKTTTSTTP--ASTTSSTTPASTTSSTTPATTTTTPG 111

Query: 401 ETEKTTPATMS 369
            T  TTP+  S
Sbjct: 112 TTSTTTPSPNS 122


>AE014296-1719|AAN11954.1|  182|Drosophila melanogaster CG16707-PB,
           isoform B protein.
          Length = 182

 Score = 37.9 bits (84), Expect = 0.017
 Identities = 25/71 (35%), Positives = 33/71 (46%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  S TS  T  T T+  IT+     + ST    +S+ + T   S    T  +TTT  PG
Sbjct: 54  PSTSTTSTTTEKTTTTPPITTSTEKTTTSTTP--ASTTSSTTPASTTSSTTPATTTTTPG 111

Query: 401 ETEKTTPATMS 369
            T  TTP+  S
Sbjct: 112 TTSTTTPSPNS 122


>AE014296-1718|AAN11953.1|  182|Drosophila melanogaster CG16707-PA,
           isoform A protein.
          Length = 182

 Score = 37.9 bits (84), Expect = 0.017
 Identities = 25/71 (35%), Positives = 33/71 (46%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  S TS  T  T T+  IT+     + ST    +S+ + T   S    T  +TTT  PG
Sbjct: 54  PSTSTTSTTTEKTTTTPPITTSTEKTTTSTTP--ASTTSSTTPASTTSSTTPATTTTTPG 111

Query: 401 ETEKTTPATMS 369
            T  TTP+  S
Sbjct: 112 TTSTTTPSPNS 122


>AE014296-1717|AAN11952.1|  183|Drosophila melanogaster CG16707-PD,
           isoform D protein.
          Length = 183

 Score = 37.9 bits (84), Expect = 0.017
 Identities = 25/71 (35%), Positives = 33/71 (46%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  S TS  T  T T+  IT+     + ST    +S+ + T   S    T  +TTT  PG
Sbjct: 55  PSTSTTSTTTEKTTTTPPITTSTEKTTTSTTP--ASTTSSTTPASTTSSTTPATTTTTPG 112

Query: 401 ETEKTTPATMS 369
            T  TTP+  S
Sbjct: 113 TTSTTTPSPNS 123


>AE014296-1716|AAF50218.1|  183|Drosophila melanogaster CG16707-PC,
           isoform C protein.
          Length = 183

 Score = 37.9 bits (84), Expect = 0.017
 Identities = 25/71 (35%), Positives = 33/71 (46%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  S TS  T  T T+  IT+     + ST    +S+ + T   S    T  +TTT  PG
Sbjct: 55  PSTSTTSTTTEKTTTTPPITTSTEKTTTSTTP--ASTTSSTTPASTTSSTTPATTTTTPG 112

Query: 401 ETEKTTPATMS 369
            T  TTP+  S
Sbjct: 113 TTSTTTPSPNS 123


>AL031027-6|CAB41537.1|  352|Drosophila melanogaster EG:80H7.11
           protein.
          Length = 352

 Score = 33.9 bits (74), Expect = 0.28
 Identities = 16/56 (28%), Positives = 26/56 (46%)
 Frame = -3

Query: 418 RPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRERGQLRRQED 251
           RPP +G + RL   P +   H   G          ++ +DV ET R++   +R E+
Sbjct: 190 RPPGVGAKLRLEWSPPRHREHEGAGASATSAAPKAYQFKDVYETKRQQAMRKRSEE 245


>AY089578-1|AAL90316.1|  325|Drosophila melanogaster RE11134p
           protein.
          Length = 325

 Score = 33.1 bits (72), Expect = 0.49
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = -3

Query: 421 QRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRERGQLRRQED 251
           +RPP +G + RL   P +   H   G          ++ +DV E+ R++   +R E+
Sbjct: 162 ERPPGVGAKLRLEWSPPRHREHEGAGASATSAAPKAYQFKDVYESKRQQAMRKRSEE 218


>AF461100-1|AAL66368.1| 1179|Drosophila melanogaster dystroglycan
           type I protein.
          Length = 1179

 Score = 33.1 bits (72), Expect = 0.49
 Identities = 21/72 (29%), Positives = 40/72 (55%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           +S  T+AT+ ++  +S ++S+S +T    +++ + T   S+   T  +TTT      E  
Sbjct: 452 SSVPTQATQPTTSASSFSSSSSTTTTS-TTATVSTTTTASSTATTTTTTTTLSESPKEGG 510

Query: 386 TPATMSAGNSSL 351
            P  +S+GN+SL
Sbjct: 511 EPDAISSGNNSL 522


>AE014298-221|AAF45636.1|  325|Drosophila melanogaster CG14781-PA
           protein.
          Length = 325

 Score = 33.1 bits (72), Expect = 0.49
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = -3

Query: 421 QRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRERGQLRRQED 251
           +RPP +G + RL   P +   H   G          ++ +DV E+ R++   +R E+
Sbjct: 162 ERPPGVGAKLRLEWSPPRHREHEGAGASATSAAPKAYQFKDVYESKRQQAMRKRSEE 218


>AE014297-3800|AAN14054.2|  881|Drosophila melanogaster CG31439-PA
           protein.
          Length = 881

 Score = 33.1 bits (72), Expect = 0.49
 Identities = 19/78 (24%), Positives = 34/78 (43%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+C    T T++  T+   + + +T    +++   T   +    T  +TTT  P  T   
Sbjct: 458 TTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTPTTTTTC 517

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T +   ++    TTT
Sbjct: 518 TPTTTTTTTTTTTTTTTT 535



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 20/82 (24%), Positives = 33/82 (40%)
 Frame = -2

Query: 578 CRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGE 399
           C   T+  T  T T++  T+   +    T    +++   T   +    T  +TTT  P  
Sbjct: 517 CTPTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTATTTPTTTTCTPTT 576

Query: 398 TEKTTPATMSAGNSSLFGKTTT 333
           T  TT  T +   ++    TTT
Sbjct: 577 TTTTTTTTTTTTTTTTTTTTTT 598



 Score = 31.5 bits (68), Expect = 1.5
 Identities = 20/83 (24%), Positives = 36/83 (43%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  + T+  T  T T++  T+   + + +T    +++   T   +    T  +TTT  P 
Sbjct: 148 PTTTTTTSTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPT 207

Query: 401 ETEKTTPATMSAGNSSLFGKTTT 333
            T  TT  T +   ++    TTT
Sbjct: 208 TTTTTTTTTTTTTTTTTTTTTTT 230



 Score = 31.5 bits (68), Expect = 1.5
 Identities = 20/83 (24%), Positives = 36/83 (43%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  + T+  T  T T++  T+   + + +T    +++   T   +    T  +TTT  P 
Sbjct: 266 PTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPT 325

Query: 401 ETEKTTPATMSAGNSSLFGKTTT 333
            T  TT  T +   ++    TTT
Sbjct: 326 TTTTTTTTTTTTTTTTTTTTTTT 348



 Score = 31.5 bits (68), Expect = 1.5
 Identities = 19/78 (24%), Positives = 32/78 (41%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+C    T T++  T+   + + +T     +    T   +    T  +TTT  P  T  T
Sbjct: 353 TTCTPTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTCTPTTTTTT 412

Query: 386 TPATMSAGNSSLFGKTTT 333
           T  T +   ++    TTT
Sbjct: 413 TSTTTTTTTTTTTTTTTT 430



 Score = 31.5 bits (68), Expect = 1.5
 Identities = 20/82 (24%), Positives = 33/82 (40%)
 Frame = -2

Query: 578 CRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGE 399
           C   T+  T  T T++  T+   +    T    +++   T   +    T  +TTT  P  
Sbjct: 435 CTPTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTT 494

Query: 398 TEKTTPATMSAGNSSLFGKTTT 333
           T  TT  T +   ++    TTT
Sbjct: 495 TTTTTTTTTTTTTTTTPTTTTT 516



 Score = 30.3 bits (65), Expect = 3.4
 Identities = 19/82 (23%), Positives = 34/82 (41%)
 Frame = -2

Query: 578 CRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGE 399
           C   T+  T +T T++  T+   + + +T     ++   T   +    T  +TTT     
Sbjct: 404 CTPTTTTTTTSTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTCTPT 463

Query: 398 TEKTTPATMSAGNSSLFGKTTT 333
           T  TT  T +   ++    TTT
Sbjct: 464 TTTTTTTTTTTTTTTTTTTTTT 485



 Score = 29.9 bits (64), Expect = 4.5
 Identities = 19/78 (24%), Positives = 34/78 (43%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T++  T+   + + +T    +++   T   +    T  +TTT  P  T  T
Sbjct: 409 TTTTTSTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTT 468

Query: 386 TPATMSAGNSSLFGKTTT 333
           T  T +   ++    TTT
Sbjct: 469 TTTTTTTTTTTTTTTTTT 486



 Score = 29.9 bits (64), Expect = 4.5
 Identities = 18/78 (23%), Positives = 33/78 (42%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+C    T T++  T+   + + +T    +++   T   +    T  +TTT     T   
Sbjct: 540 TTCTPTTTTTTTTTTTTTTTTTTATTTPTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTC 599

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T +   ++    TTT
Sbjct: 600 TPTTTTTTTTTTTTTTTT 617



 Score = 29.9 bits (64), Expect = 4.5
 Identities = 19/78 (24%), Positives = 32/78 (41%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T++  T+   +    T    +++   T   +    T  +TTT  P  T  T
Sbjct: 578 TTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTT 637

Query: 386 TPATMSAGNSSLFGKTTT 333
           T  T +   ++    TTT
Sbjct: 638 TTTTTTTTTTTTTTTTTT 655



 Score = 29.9 bits (64), Expect = 4.5
 Identities = 18/78 (23%), Positives = 33/78 (42%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+C    T T++  T+   + + +T    +++   T   +    T  +TTT     T   
Sbjct: 597 TTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTC 656

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T +   ++    TTT
Sbjct: 657 TPTTTTTTTTTTTTTTTT 674



 Score = 29.5 bits (63), Expect = 6.0
 Identities = 19/83 (22%), Positives = 35/83 (42%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  + T+  T  T T++  T+   + + +T    +++   T   +    T  +TTT    
Sbjct: 173 PTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTT 232

Query: 401 ETEKTTPATMSAGNSSLFGKTTT 333
            T   TP T +   ++    TTT
Sbjct: 233 TTTTCTPTTTTTTTTTTTTTTTT 255



 Score = 29.5 bits (63), Expect = 6.0
 Identities = 19/78 (24%), Positives = 34/78 (43%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T++  T+   + + +T    +++   T   +    T  +TTT  P  T  T
Sbjct: 186 TTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTT 245

Query: 386 TPATMSAGNSSLFGKTTT 333
           T  T +   ++    TTT
Sbjct: 246 TTTTTTTTTTTTTTTTTT 263



 Score = 29.5 bits (63), Expect = 6.0
 Identities = 19/83 (22%), Positives = 35/83 (42%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  + T+  T  T T++  T+   + + +T    +++   T   +    T  +TTT    
Sbjct: 291 PTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTT 350

Query: 401 ETEKTTPATMSAGNSSLFGKTTT 333
            T   TP T +   ++    TTT
Sbjct: 351 TTTTCTPTTTTTTTTTTTTTTTT 373



 Score = 29.5 bits (63), Expect = 6.0
 Identities = 19/78 (24%), Positives = 34/78 (43%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T++  T+   + + +T    +++   T   +    T  +TTT  P  T  T
Sbjct: 304 TTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTT 363

Query: 386 TPATMSAGNSSLFGKTTT 333
           T  T +   ++    TTT
Sbjct: 364 TTTTTTTTTTTTTTTTTT 381



 Score = 29.1 bits (62), Expect = 7.9
 Identities = 19/78 (24%), Positives = 33/78 (42%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T   T  T T++  T+   + + +T    +++   T   +    T  +TTT  P  T  T
Sbjct: 238 TPTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTT 297

Query: 386 TPATMSAGNSSLFGKTTT 333
           T  T +   ++    TTT
Sbjct: 298 TTTTTTTTTTTTTTTTTT 315



 Score = 29.1 bits (62), Expect = 7.9
 Identities = 21/84 (25%), Positives = 35/84 (41%), Gaps = 2/84 (2%)
 Frame = -2

Query: 578 CRSRTSCGTRATRTSSKITSRANSNSYSTN--R*LSSSANITIKLSNWMLTLASTTTA*P 405
           C   T+  T  T T++  T+ A +   +T      +++   T   +    T  +TTT  P
Sbjct: 542 CTPTTTTTTTTTTTTTTTTTTATTTPTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTCTP 601

Query: 404 GETEKTTPATMSAGNSSLFGKTTT 333
             T  TT  T +   ++    TTT
Sbjct: 602 TTTTTTTTTTTTTTTTTTTTTTTT 625



 Score = 29.1 bits (62), Expect = 7.9
 Identities = 18/78 (23%), Positives = 31/78 (39%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+C    T T++  T+   + + +T     +    T   +    T  +TTT     T   
Sbjct: 570 TTCTPTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTC 629

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T +   ++    TTT
Sbjct: 630 TPTTTTTTTTTTTTTTTT 647


>AE013599-2171|AAO41377.2| 1179|Drosophila melanogaster CG18250-PC,
           isoform C protein.
          Length = 1179

 Score = 33.1 bits (72), Expect = 0.49
 Identities = 21/72 (29%), Positives = 40/72 (55%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           +S  T+AT+ ++  +S ++S+S +T    +++ + T   S+   T  +TTT      E  
Sbjct: 452 SSVPTQATQPTTSASSFSSSSSTTTTS-TTATVSTTTTASSTATTTTTTTTLSESPKEGG 510

Query: 386 TPATMSAGNSSL 351
            P  +S+GN+SL
Sbjct: 511 EPDAISSGNNSL 522


>AY864367-1|AAX38005.1|  574|Drosophila melanogaster scavenger
           receptor protein.
          Length = 574

 Score = 31.5 bits (68), Expect = 1.5
 Identities = 22/78 (28%), Positives = 31/78 (39%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           T+  T  T T    T+   + + +T R  ++    T   +    T  STT      T  T
Sbjct: 366 TTTSTSTTTTKRPTTTTTTTKATTTKRTTTTKKPTTTSTTPKPTTTTSTTPKSTTSTTST 425

Query: 386 TPATMSAGNSSLFGKTTT 333
           TP T +  N     KTTT
Sbjct: 426 TPTTTTTINVFTTKKTTT 443



 Score = 29.5 bits (63), Expect = 6.0
 Identities = 21/81 (25%), Positives = 37/81 (45%)
 Frame = -2

Query: 575 RSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGET 396
           +S T+  T  T T++  TS   +   +T    ++ A  T + +       ++TT  P  T
Sbjct: 353 KSTTTTTTTTTTTTTTSTSTTTTKRPTTTT-TTTKATTTKRTTTTKKPTTTSTTPKPTTT 411

Query: 395 EKTTPATMSAGNSSLFGKTTT 333
             TTP + ++  S+    TTT
Sbjct: 412 TSTTPKSTTSTTSTTPTTTTT 432


>AE014298-611|AAF45929.2|  483|Drosophila melanogaster CG32774-PA
           protein.
          Length = 483

 Score = 31.5 bits (68), Expect = 1.5
 Identities = 22/71 (30%), Positives = 37/71 (52%)
 Frame = -2

Query: 545 TRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTTPATMSA 366
           T  SS  T+  ++ + +T+   +SSA  T   ++  LT +STT A  G T  T  +T + 
Sbjct: 56  TTESSSTTAPLSTTTEATSTSTASSATSTTVPASTTLTSSSTTQA--GITTSTETSTSAQ 113

Query: 365 GNSSLFGKTTT 333
             S++   T+T
Sbjct: 114 STSTILADTST 124


>AE014297-1476|AAF54775.1|  588|Drosophila melanogaster CG4066-PA
           protein.
          Length = 588

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSS----ANITIKLSNWMLTLASTTTA*PGE 399
           T   T AT T+   TS + +N  +T+   ++     ++ T + S  +L    +TT+    
Sbjct: 89  THSSTTATTTTDSSTSHSKTNDSTTDESTTTDFATLSSTTAQASTRILKTTVSTTSSTTT 148

Query: 398 TEKTTPATM-SAGNSSLFGKTTT 333
           T  T+P+T  S  N+S   +TTT
Sbjct: 149 TSTTSPSTSDSTTNNSTTTETTT 171


>S61744-1|AAB26699.1|  394|Drosophila melanogaster omb protein.
          Length = 394

 Score = 30.7 bits (66), Expect = 2.6
 Identities = 20/46 (43%), Positives = 23/46 (50%)
 Frame = +3

Query: 105 GPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVSSHWNHS 242
           G  +S    P S PAGTP     T VGLPP+P       SS  N+S
Sbjct: 146 GHHLSTTEEPPS-PAGTPPP---TIVGLPPIPPPNNNSSSSSSNNS 187


>S61735-1|AAB26698.1|  326|Drosophila melanogaster omb protein.
          Length = 326

 Score = 30.7 bits (66), Expect = 2.6
 Identities = 20/46 (43%), Positives = 23/46 (50%)
 Frame = +3

Query: 105 GPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVSSHWNHS 242
           G  +S    P S PAGTP     T VGLPP+P       SS  N+S
Sbjct: 146 GHHLSTTEEPPS-PAGTPPP---TIVGLPPIPPPNNNSSSSSSNNS 187


>S61732-1|AAB26697.1|  447|Drosophila melanogaster omb protein.
          Length = 447

 Score = 30.7 bits (66), Expect = 2.6
 Identities = 20/46 (43%), Positives = 23/46 (50%)
 Frame = +3

Query: 105 GPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVSSHWNHS 242
           G  +S    P S PAGTP     T VGLPP+P       SS  N+S
Sbjct: 146 GHHLSTTEEPPS-PAGTPPP---TIVGLPPIPPPNNNSSSSSSNNS 187


>M81796-1|AAA28736.1|  974|Drosophila melanogaster optomotor-blind
           protein.
          Length = 974

 Score = 30.7 bits (66), Expect = 2.6
 Identities = 20/46 (43%), Positives = 23/46 (50%)
 Frame = +3

Query: 105 GPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVSSHWNHS 242
           G  +S    P S PAGTP     T VGLPP+P       SS  N+S
Sbjct: 146 GHHLSTTEEPPS-PAGTPPP---TIVGLPPIPPPNNNSSSSSSNNS 187


>AE014298-1399|AAF46544.1| 4498|Drosophila melanogaster CG2989-PA
            protein.
          Length = 4498

 Score = 30.7 bits (66), Expect = 2.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = -2

Query: 581  PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
            P  + T+  T A   ++K ++  N+N+ + +   SS+ N  +KL+N + T  + TT  P 
Sbjct: 972  PETTTTTTTTTAGTETAKASTTTNNNNNNNSHYNSSNNNNNVKLNNQLPTEENITTT-PS 1030

Query: 401  ET--EKTTPATMSAGNSSLFGKTTT 333
             T   +TT  T      +    TTT
Sbjct: 1031 TTAQSETTTTTNETTEPNESTSTTT 1055



 Score = 29.9 bits (64), Expect = 4.5
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = -2

Query: 536  SSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTTPATMSAGNS 357
            +S   S  N+N+   N  L +  NIT   S    +  +TTT    E  ++T  T ++  +
Sbjct: 1001 NSHYNSSNNNNNVKLNNQLPTEENITTTPSTTAQSETTTTTNETTEPNESTSTTTTSITN 1060

Query: 356  SLFGKTTT 333
            +L   TTT
Sbjct: 1061 NLHTTTTT 1068


>AE014298-631|AAF45946.2|  972|Drosophila melanogaster CG3578-PA
           protein.
          Length = 972

 Score = 30.7 bits (66), Expect = 2.6
 Identities = 20/46 (43%), Positives = 23/46 (50%)
 Frame = +3

Query: 105 GPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVSSHWNHS 242
           G  +S    P S PAGTP     T VGLPP+P       SS  N+S
Sbjct: 146 GHHLSTTEEPPS-PAGTPPP---TIVGLPPIPPPNNNSSSSSSNNS 187


>AY060705-1|AAL28253.1|  167|Drosophila melanogaster GH14622p
           protein.
          Length = 167

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 15/41 (36%), Positives = 19/41 (46%)
 Frame = -3

Query: 214 LVFIPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVG 92
           L +  G GG P A+P   PGV  G  +G   G + G    G
Sbjct: 68  LPYAGGAGGMPAAMPGAMPGVMPGAMSGAMPGAMPGAMSCG 108


>AE014298-1577|AAF48013.1|  167|Drosophila melanogaster CG1394-PA
           protein.
          Length = 167

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 15/41 (36%), Positives = 19/41 (46%)
 Frame = -3

Query: 214 LVFIPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVG 92
           L +  G GG P A+P   PGV  G  +G   G + G    G
Sbjct: 68  LPYAGGAGGMPAAMPGAMPGVMPGAMSGAMPGAMPGAMSCG 108


>AE014296-1899|AAF50100.2|  150|Drosophila melanogaster CG32071-PA
           protein.
          Length = 150

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 20/59 (33%), Positives = 30/59 (50%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEK 390
           +S  T  + TSS  TS  +S+S S     SS+++ T   +    T A+TTT+   E  K
Sbjct: 29  SSQATSTSPTSSSSTSPTSSSSTSPTSSSSSTSSATTTTTTTTTTTAATTTSTTTEKSK 87


>AE014134-2885|AAF53636.3| 1912|Drosophila melanogaster CG7527-PA,
            isoform A protein.
          Length = 1912

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = +2

Query: 26   CHCH-GWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC  GW+      G    VP +P T ++     FA SF P R+S
Sbjct: 1361 CHCQPGWM------GPGCNVPTIPTTFKAQSYVKFALSFEPDRFS 1399


>AE014134-2884|ABI31322.1| 1839|Drosophila melanogaster CG7527-PB,
            isoform B protein.
          Length = 1839

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = +2

Query: 26   CHCH-GWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC  GW+      G    VP +P T ++     FA SF P R+S
Sbjct: 1288 CHCQPGWM------GPGCNVPTIPTTFKAQSYVKFALSFEPDRFS 1326


>AE014134-2883|AAZ66476.1| 3101|Drosophila melanogaster CG7100-PL,
            isoform L protein.
          Length = 3101

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2620 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2658


>AE014134-2882|AAZ66475.1| 3100|Drosophila melanogaster CG7100-PK,
            isoform K protein.
          Length = 3100

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2620 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2658


>AE014134-2881|AAZ66474.1| 3100|Drosophila melanogaster CG7100-PI,
            isoform I protein.
          Length = 3100

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2619 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2657


>AE014134-2880|AAZ66473.1| 3099|Drosophila melanogaster CG7100-PJ,
            isoform J protein.
          Length = 3099

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2619 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2657


>AE014134-2879|AAN10998.1| 3097|Drosophila melanogaster CG7100-PE,
            isoform E protein.
          Length = 3097

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2616 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2654


>AE014134-2878|AAN10997.1| 3096|Drosophila melanogaster CG7100-PG,
            isoform G protein.
          Length = 3096

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2616 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2654


>AE014134-2877|AAN10996.1| 3096|Drosophila melanogaster CG7100-PA,
            isoform A protein.
          Length = 3096

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2615 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2653


>AE014134-2876|AAN10995.1| 3095|Drosophila melanogaster CG7100-PC,
            isoform C protein.
          Length = 3095

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2615 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2653


>AE014134-2875|AAF53635.1| 3097|Drosophila melanogaster CG7100-PD,
            isoform D protein.
          Length = 3097

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2616 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2654


>AE014134-2874|AAN10994.1| 3096|Drosophila melanogaster CG7100-PF,
            isoform F protein.
          Length = 3096

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2616 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2654


>AE014134-2873|AAN10993.1| 3096|Drosophila melanogaster CG7100-PB,
            isoform B protein.
          Length = 3096

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2615 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2653


>AE014134-2872|AAN10992.1| 3095|Drosophila melanogaster CG7100-PH,
            isoform H protein.
          Length = 3095

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2615 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2653


>AB002397-1|BAA22151.1| 3097|Drosophila melanogaster DN-cadherin
            protein.
          Length = 3097

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 26   CHCHGWIMKP*YSGLSATVPLLPHTRRSPYESTFASSFSPCRYS 157
            CHC     +P ++G +  +P +P T ++     +A SF P R+S
Sbjct: 2616 CHC-----RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFS 2654


>DQ831954-1|ABJ09069.1| 1223|Drosophila melanogaster SnoN protein.
          Length = 1223

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -3

Query: 427 RVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           RV R  D    +R +QP   LA   S+  ++RD +D E   R+V+E  R R
Sbjct: 496 RVVRSTDKRYAERTYQPNVALAPRKSILSKERD-KDRERMEREVMERQRLR 545


>DQ831953-1|ABJ09068.1| 1223|Drosophila melanogaster SnoN protein.
          Length = 1223

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -3

Query: 427 RVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           RV R  D    +R +QP   LA   S+  ++RD +D E   R+V+E  R R
Sbjct: 496 RVVRSTDKRYAERTYQPNVALAPRKSILSKERD-KDRERMEREVMERQRLR 545


>DQ831952-1|ABJ09067.1| 1223|Drosophila melanogaster SnoN protein.
          Length = 1223

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -3

Query: 427 RVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           RV R  D    +R +QP   LA   S+  ++RD +D E   R+V+E  R R
Sbjct: 496 RVVRSTDKRYAERTYQPNVALAPRKSILSKERD-KDRERMEREVMERQRLR 545


>DQ138812-1|ABA86418.1|  866|Drosophila melanogaster CG7093 protein.
          Length = 866

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -3

Query: 427 RVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           RV R  D    +R +QP   LA   S+  ++RD +D E   R+V+E  R R
Sbjct: 146 RVVRSTDKRYAERTYQPNVALAPRKSILSKERD-KDRERMEREVMERQRLR 195


>BT011354-1|AAR96146.1|  492|Drosophila melanogaster RE71830p
           protein.
          Length = 492

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKIT-SRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*P 405
           P   RT     + RTS+  T S +NS S S++   ++S  +  +       ++ST++   
Sbjct: 333 PVMPRTLLNATSVRTSTSSTGSTSNSVSVSSSTNANTSMTVLNQSQTRSRIVSSTSSTDS 392

Query: 404 GET--EKTTPATMSAGNSS 354
            ET  E++T +T S+ +SS
Sbjct: 393 TETITERSTTSTSSSSSSS 411


>BT001719-1|AAN71474.1|  655|Drosophila melanogaster RE68846p
           protein.
          Length = 655

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKIT-SRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*P 405
           P   RT     + RTS+  T S +NS S S++   ++S  +  +       ++ST++   
Sbjct: 525 PVMPRTLLNATSVRTSTSSTGSTSNSVSVSSSTNANTSMTVLNQSQTRSRIVSSTSSTDS 584

Query: 404 GET--EKTTPATMSAGNSS 354
            ET  E++T +T S+ +SS
Sbjct: 585 TETITERSTTSTSSSSSSS 603


>AY113304-1|AAM29309.1|  818|Drosophila melanogaster AT27185p
           protein.
          Length = 818

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = -3

Query: 382 QPPCQLATHLSLGRQQRDIQDTEHRI-RDVLETGRERGQLRRQED 251
           QPP     HLSL +Q R+++D + ++  DV E   E  + ++ E+
Sbjct: 486 QPPLMEVKHLSLEQQIRNLRDVQKKVDLDVEEEEEEEEEEQQAEE 530


>AY071657-1|AAL49279.1|  208|Drosophila melanogaster RE73905p
           protein.
          Length = 208

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +3

Query: 93  PTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLP 200
           P+  G  M+P   P  +P   PG+R G  + +PPLP
Sbjct: 45  PSTAGNGMAPPP-PTRLPPPPPGARAGLLLPVPPLP 79


>AY058699-1|AAL13928.1|  600|Drosophila melanogaster LD42024p
           protein.
          Length = 600

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +3

Query: 93  PTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLP 200
           P+  G  M+P   P  +P   PG+R G  + +PPLP
Sbjct: 437 PSTAGNGMAPPP-PTRLPPPPPGARAGLLLPVPPLP 471


>AM282581-1|CAK54357.1| 1011|Drosophila melanogaster dSki protein
           long isoform protein.
          Length = 1011

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -3

Query: 427 RVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           RV R  D    +R +QP   LA   S+  ++RD +D E   R+V+E  R R
Sbjct: 489 RVVRSTDKRYAERTYQPNVALAPRKSILSKERD-KDRERMEREVMERQRLR 538


>AE014298-3195|AAF50943.2|  208|Drosophila melanogaster CG17600-PB,
           isoform B protein.
          Length = 208

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +3

Query: 93  PTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLP 200
           P+  G  M+P   P  +P   PG+R G  + +PPLP
Sbjct: 45  PSTAGNGMAPPP-PTRLPPPPPGARAGLLLPVPPLP 79


>AE014298-3192|AAF50946.2|  600|Drosophila melanogaster CG17600-PA,
           isoform A protein.
          Length = 600

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +3

Query: 93  PTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLP 200
           P+  G  M+P   P  +P   PG+R G  + +PPLP
Sbjct: 437 PSTAGNGMAPPP-PTRLPPPPPGARAGLLLPVPPLP 471


>AE014134-1364|AAF52579.2|  887|Drosophila melanogaster CG7093-PA
           protein.
          Length = 887

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -3

Query: 427 RVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           RV R  D    +R +QP   LA   S+  ++RD +D E   R+V+E  R R
Sbjct: 160 RVVRSTDKRYAERTYQPNVALAPRKSILSKERD-KDRERMEREVMERQRLR 209


>AE013599-482|AAF59206.3|  655|Drosophila melanogaster CG1399-PA,
           isoform A protein.
          Length = 655

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKIT-SRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*P 405
           P   RT     + RTS+  T S +NS S S++   ++S  +  +       ++ST++   
Sbjct: 525 PVMPRTLLNATSVRTSTSSTGSTSNSVSVSSSTNANTSMTVLNQSQTRSRIVSSTSSTDS 584

Query: 404 GET--EKTTPATMSAGNSS 354
            ET  E++T +T S+ +SS
Sbjct: 585 TETITERSTTSTSSSSSSS 603


>AE013599-481|AAF59205.2| 1399|Drosophila melanogaster CG1399-PB,
            isoform B protein.
          Length = 1399

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = -2

Query: 581  PCRSRTSCGTRATRTSSKIT-SRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*P 405
            P   RT     + RTS+  T S +NS S S++   ++S  +  +       ++ST++   
Sbjct: 1269 PVMPRTLLNATSVRTSTSSTGSTSNSVSVSSSTNANTSMTVLNQSQTRSRIVSSTSSTDS 1328

Query: 404  GET--EKTTPATMSAGNSS 354
             ET  E++T +T S+ +SS
Sbjct: 1329 TETITERSTTSTSSSSSSS 1347


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,053,335
Number of Sequences: 53049
Number of extensions: 770965
Number of successful extensions: 3249
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 2574
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3159
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4003789140
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).