SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT004874-1|AAO45230.1|  453|Drosophila melanogaster LD23573p pro...    74   2e-13
AE013599-1745|AAF58356.1|  453|Drosophila melanogaster CG33156-P...    74   2e-13
BT001677-1|AAN71432.1|  490|Drosophila melanogaster RE54276p pro...    72   7e-13
BT001490-1|AAN71245.1|  454|Drosophila melanogaster LD26002p pro...    72   7e-13
AE013599-1744|AAM68591.2|  490|Drosophila melanogaster CG33156-P...    72   7e-13
AE013599-1743|AAF58355.1|  454|Drosophila melanogaster CG33156-P...    72   7e-13
BT014633-1|AAT27257.1|  548|Drosophila melanogaster RH58004p pro...    64   1e-10
AE013599-1741|AAM68589.1|  548|Drosophila melanogaster CG6145-PC...    64   1e-10
AE013599-1740|AAF58358.1|  520|Drosophila melanogaster CG6145-PA...    64   1e-10
BT001874-1|AAN71646.1|  375|Drosophila melanogaster SD09038p pro...    60   3e-09
AE013599-1746|AAF58357.1|  375|Drosophila melanogaster CG33156-P...    60   3e-09
AY069729-1|AAL39874.1|  420|Drosophila melanogaster LP03268p pro...    56   5e-08
AE013599-1742|AAM68590.1|  420|Drosophila melanogaster CG6145-PB...    56   5e-08
AE014296-1918|AAN11904.1| 1074|Drosophila melanogaster CG32082-P...    28   9.0  

>BT004874-1|AAO45230.1|  453|Drosophila melanogaster LD23573p
           protein.
          Length = 453

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 40/78 (51%), Positives = 47/78 (60%)
 Frame = +1

Query: 274 RRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQIL 453
           RRTRSLNAPSP+QQ     +  +                   KPPLTVLVIKKV DA +L
Sbjct: 58  RRTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVL 117

Query: 454 APFVQLVHWLVHDKSMVV 507
           APFV LV WL+ +K+MVV
Sbjct: 118 APFVYLVDWLLQEKNMVV 135



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/32 (87%), Positives = 29/32 (90%)
 Frame = +2

Query: 314 KFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 71  QFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 102


>AE013599-1745|AAF58356.1|  453|Drosophila melanogaster CG33156-PB,
           isoform B protein.
          Length = 453

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 40/78 (51%), Positives = 47/78 (60%)
 Frame = +1

Query: 274 RRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQIL 453
           RRTRSLNAPSP+QQ     +  +                   KPPLTVLVIKKV DA +L
Sbjct: 58  RRTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVL 117

Query: 454 APFVQLVHWLVHDKSMVV 507
           APFV LV WL+ +K+MVV
Sbjct: 118 APFVYLVDWLLQEKNMVV 135



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/32 (87%), Positives = 29/32 (90%)
 Frame = +2

Query: 314 KFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 71  QFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 102


>BT001677-1|AAN71432.1|  490|Drosophila melanogaster RE54276p
           protein.
          Length = 490

 Score = 71.7 bits (168), Expect = 7e-13
 Identities = 39/77 (50%), Positives = 46/77 (59%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP+QQ     +  +                   KPPLTVLVIKKV DA +LA
Sbjct: 96  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLA 155

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFV LV WL+ +K+MVV
Sbjct: 156 PFVYLVDWLLQEKNMVV 172



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/32 (87%), Positives = 29/32 (90%)
 Frame = +2

Query: 314 KFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 108 QFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 139


>BT001490-1|AAN71245.1|  454|Drosophila melanogaster LD26002p
           protein.
          Length = 454

 Score = 71.7 bits (168), Expect = 7e-13
 Identities = 39/77 (50%), Positives = 46/77 (59%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP+QQ     +  +                   KPPLTVLVIKKV DA +LA
Sbjct: 60  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLA 119

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFV LV WL+ +K+MVV
Sbjct: 120 PFVYLVDWLLQEKNMVV 136



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/32 (87%), Positives = 29/32 (90%)
 Frame = +2

Query: 314 KFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 72  QFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 103


>AE013599-1744|AAM68591.2|  490|Drosophila melanogaster CG33156-PE,
           isoform E protein.
          Length = 490

 Score = 71.7 bits (168), Expect = 7e-13
 Identities = 39/77 (50%), Positives = 46/77 (59%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP+QQ     +  +                   KPPLTVLVIKKV DA +LA
Sbjct: 96  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLA 155

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFV LV WL+ +K+MVV
Sbjct: 156 PFVYLVDWLLQEKNMVV 172



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/32 (87%), Positives = 29/32 (90%)
 Frame = +2

Query: 314 KFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 108 QFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 139


>AE013599-1743|AAF58355.1|  454|Drosophila melanogaster CG33156-PA,
           isoform A protein.
          Length = 454

 Score = 71.7 bits (168), Expect = 7e-13
 Identities = 39/77 (50%), Positives = 46/77 (59%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP+QQ     +  +                   KPPLTVLVIKKV DA +LA
Sbjct: 60  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLA 119

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFV LV WL+ +K+MVV
Sbjct: 120 PFVYLVDWLLQEKNMVV 136



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/32 (87%), Positives = 29/32 (90%)
 Frame = +2

Query: 314 KFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 72  QFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 103


>BT014633-1|AAT27257.1|  548|Drosophila melanogaster RH58004p
           protein.
          Length = 548

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 38/77 (49%), Positives = 43/77 (55%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP Q      +  +                   KPPLTVLVIKK  D+Q+L 
Sbjct: 109 RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKK-KDSQVLP 167

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFVQLV WLV +K MVV
Sbjct: 168 PFVQLVEWLVQEKHMVV 184



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 28/34 (82%), Positives = 29/34 (85%)
 Frame = +2

Query: 308 YNKFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +  FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 119 FQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 152


>AE013599-1741|AAM68589.1|  548|Drosophila melanogaster CG6145-PC,
           isoform C protein.
          Length = 548

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 38/77 (49%), Positives = 43/77 (55%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP Q      +  +                   KPPLTVLVIKK  D+Q+L 
Sbjct: 109 RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKK-KDSQVLP 167

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFVQLV WLV +K MVV
Sbjct: 168 PFVQLVEWLVQEKHMVV 184



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 28/34 (82%), Positives = 29/34 (85%)
 Frame = +2

Query: 308 YNKFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +  FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 119 FQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 152


>AE013599-1740|AAF58358.1|  520|Drosophila melanogaster CG6145-PA,
           isoform A protein.
          Length = 520

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 38/77 (49%), Positives = 43/77 (55%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP Q      +  +                   KPPLTVLVIKK  D+Q+L 
Sbjct: 81  RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKK-KDSQVLP 139

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFVQLV WLV +K MVV
Sbjct: 140 PFVQLVEWLVQEKHMVV 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 28/34 (82%), Positives = 29/34 (85%)
 Frame = +2

Query: 308 YNKFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +  FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 91  FQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 124


>BT001874-1|AAN71646.1|  375|Drosophila melanogaster SD09038p
           protein.
          Length = 375

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/36 (75%), Positives = 31/36 (86%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVV 507
           KPPLTVLVIKKV DA +LAPFV LV WL+ +K+MVV
Sbjct: 22  KPPLTVLVIKKVSDASVLAPFVYLVDWLLQEKNMVV 57



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 21/24 (87%), Positives = 21/24 (87%)
 Frame = +2

Query: 338 MKNSAMVMQIQDPASQRLTWSSLP 409
           MKNSAMVMQIQDPASQRLTW   P
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPP 24


>AE013599-1746|AAF58357.1|  375|Drosophila melanogaster CG33156-PC,
           isoform C protein.
          Length = 375

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/36 (75%), Positives = 31/36 (86%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVV 507
           KPPLTVLVIKKV DA +LAPFV LV WL+ +K+MVV
Sbjct: 22  KPPLTVLVIKKVSDASVLAPFVYLVDWLLQEKNMVV 57



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 21/24 (87%), Positives = 21/24 (87%)
 Frame = +2

Query: 338 MKNSAMVMQIQDPASQRLTWSSLP 409
           MKNSAMVMQIQDPASQRLTW   P
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPP 24


>AY069729-1|AAL39874.1|  420|Drosophila melanogaster LP03268p
           protein.
          Length = 420

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVV 507
           KPPLTVLVIKK  D+Q+L PFVQLV WLV +K MVV
Sbjct: 22  KPPLTVLVIKK-KDSQVLPPFVQLVEWLVQEKHMVV 56



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 21/24 (87%), Positives = 21/24 (87%)
 Frame = +2

Query: 338 MKNSAMVMQIQDPASQRLTWSSLP 409
           MKNSAMVMQIQDPASQRLTW   P
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPP 24


>AE013599-1742|AAM68590.1|  420|Drosophila melanogaster CG6145-PB,
           isoform B protein.
          Length = 420

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVV 507
           KPPLTVLVIKK  D+Q+L PFVQLV WLV +K MVV
Sbjct: 22  KPPLTVLVIKK-KDSQVLPPFVQLVEWLVQEKHMVV 56



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 21/24 (87%), Positives = 21/24 (87%)
 Frame = +2

Query: 338 MKNSAMVMQIQDPASQRLTWSSLP 409
           MKNSAMVMQIQDPASQRLTW   P
Sbjct: 1   MKNSAMVMQIQDPASQRLTWYKPP 24


>AE014296-1918|AAN11904.1| 1074|Drosophila melanogaster CG32082-PA
           protein.
          Length = 1074

 Score = 28.3 bits (60), Expect = 9.0
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = +1

Query: 205 RRQYSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGH-ANPGSG 378
           ++Q  +E+ + EL++S E    RRR  S    SP +      +  +K+R G  ANP  G
Sbjct: 457 QQQQDYEA-QLELMESHEATYRRRRNHSAEDSSPTRMFGDTIKQQKKYRPGSGANPRPG 514


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,416,346
Number of Sequences: 53049
Number of extensions: 717085
Number of successful extensions: 1908
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1787
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1894
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2600432100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).