SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0112
         (679 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41994-9|AAK31523.1|  786|Caenorhabditis elegans Hypothetical pr...    30   1.3  
AL132847-1|CAB63371.1|  375|Caenorhabditis elegans Hypothetical ...    28   7.0  

>U41994-9|AAK31523.1|  786|Caenorhabditis elegans Hypothetical
           protein F59A6.3 protein.
          Length = 786

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 2/75 (2%)
 Frame = -1

Query: 310 GSCTRPSGRW--CEATIRGIILNASKAETSLAESGKDMLTVEPRESGGSKQCDFTSRVSH 137
           G+C+ PS  W  C  T        + + TSL  S  D  + EPR S  +   D T+    
Sbjct: 92  GACSDPSPVWTNCTETTSTASTEFTISSTSLKTSTSDSTSTEPRISTTTDTKDTTTEDPV 151

Query: 136 SKRETRRRSPFGSRR 92
           S  +    SP  + R
Sbjct: 152 SSTDQSSTSPHETTR 166


>AL132847-1|CAB63371.1|  375|Caenorhabditis elegans Hypothetical
           protein Y48G10A.2 protein.
          Length = 375

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 11/51 (21%), Positives = 28/51 (54%)
 Frame = -1

Query: 271 TIRGIILNASKAETSLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETR 119
           +++G I + +    ++    K ++  EP+E+   +  D+ + ++HSK E +
Sbjct: 306 SLKGQIKSENYTSIAVTRLYKMLIRTEPKETALRRAADYLNELTHSKTEKK 356


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,547,159
Number of Sequences: 27780
Number of extensions: 310380
Number of successful extensions: 829
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 793
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 829
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1539654388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).