SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0092
         (720 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin pr...    31   0.83 
U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory ...    31   0.83 
Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical pr...    30   1.9  
Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical pr...    29   2.5  
Z81119-8|CAB03340.1|  504|Caenorhabditis elegans Hypothetical pr...    29   3.3  
AC024843-6|AAF60844.3|  525|Caenorhabditis elegans Hypothetical ...    29   4.4  
Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical p...    28   5.8  
Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical pr...    28   5.8  
Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical pr...    28   5.8  

>X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin
           protein.
          Length = 441

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  DWI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVDWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory
           abnormality protein7 protein.
          Length = 441

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  DWI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVDWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical
           protein B0272.1 protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 21/93 (22%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R V   +    ++       +R ++ +         
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGVKMAATFVGNSTAIQELFKRISEQFTAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
           +   HW    G+D M F  +  N+N  V +++Q
Sbjct: 395 L---HWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical
           protein C54C6.2 protein.
          Length = 444

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + +S +F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>Z81119-8|CAB03340.1|  504|Caenorhabditis elegans Hypothetical
           protein T10H4.10 protein.
          Length = 504

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +2

Query: 53  DTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFN 193
           D    +L  R   G   +G   IF  VR    RF++ R D++  PFN
Sbjct: 200 DPEFEKLVSRLAKGFENTGFLDIFCPVRILESRFLKWRQDTIFEPFN 246


>AC024843-6|AAF60844.3|  525|Caenorhabditis elegans Hypothetical
           protein Y61A9LA.3b protein.
          Length = 525

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = +2

Query: 134 RSCRFRFVRDRHDSVRPPFNGQLRTGTDKGNPTV*LKQSIGWPSRVLTQCDFCPVL 301
           ++ R +F +  H  + PP  G++R   D GN        + W  +V++  DF  +L
Sbjct: 411 QAARIQFFQSLHTLIPPPIFGKMRKCVDSGN-------DMDWCMQVISSDDFREIL 459


>Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical
           protein K01G5.7 protein.
          Length = 449

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 18/85 (21%), Positives = 34/85 (40%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R +   +    ++       +R ++ +         
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN 312
           +   HW    G+D M F  +  N+N
Sbjct: 395 L---HWYTGEGMDEMEFTEAESNMN 416


>Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical protein
            F32H2.5 protein.
          Length = 2586

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -1

Query: 312  VDIQSTGQKSHCVNTREGHPML 247
            VD+ ST Q  HC+     HP+L
Sbjct: 1289 VDLVSTDQIRHCIEANSSHPLL 1310


>Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical
           protein C36E8.5 protein.
          Length = 450

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 18/85 (21%), Positives = 34/85 (40%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R +   +    ++       +R ++ +         
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN 312
           +   HW    G+D M F  +  N+N
Sbjct: 395 L---HWYTGEGMDEMEFTEAESNMN 416


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,941,489
Number of Sequences: 27780
Number of extensions: 358238
Number of successful extensions: 882
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 859
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 876
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).