SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF100669-1|AAK39265.1|  931|Caenorhabditis elegans Hypothetical ...    41   6e-04
AF026211-4|AAB71295.1|  416|Caenorhabditis elegans Collagen prot...    32   0.34 
AL022716-5|CAB97232.1|  291|Caenorhabditis elegans Hypothetical ...    31   0.46 
AF022985-12|AAB69959.1|  319|Caenorhabditis elegans Collagen pro...    31   0.46 
L15419-1|AAA17726.1|  308|Caenorhabditis elegans col-40 collagen...    31   0.60 
Z99281-6|CAB54458.2|  625|Caenorhabditis elegans Hypothetical pr...    30   1.1  
Z99281-5|CAB54457.1|  553|Caenorhabditis elegans Hypothetical pr...    30   1.1  
AL032632-7|CAA21586.1|  313|Caenorhabditis elegans Hypothetical ...    30   1.1  
Z78418-5|CAB01694.2|  361|Caenorhabditis elegans Hypothetical pr...    30   1.4  
Z82083-5|CAB04973.1|  298|Caenorhabditis elegans Hypothetical pr...    29   1.8  
U41994-9|AAK31523.1|  786|Caenorhabditis elegans Hypothetical pr...    29   1.8  
AF022985-10|AAB69961.1|  325|Caenorhabditis elegans Collagen pro...    29   1.8  
AF022985-9|AAB69960.1|  314|Caenorhabditis elegans Collagen prot...    29   1.8  
U53332-11|AAK31531.1|  668|Caenorhabditis elegans Protein tyrosi...    29   2.4  
S47168-2|AAB23866.2|  919|Caenorhabditis elegans UNC-5 protein.        29   2.4  
S47168-1|AAB23867.2|  947|Caenorhabditis elegans UNC-5 protein.        29   2.4  
AF036698-5|AAB88356.2|  567|Caenorhabditis elegans Uncoordinated...    29   2.4  
AF036698-4|AAB88355.1|  919|Caenorhabditis elegans Uncoordinated...    29   2.4  
AF015882-1|AAC21678.1|  668|Caenorhabditis elegans protein tyros...    29   2.4  
Z49131-6|CAA88979.1|  297|Caenorhabditis elegans Hypothetical pr...    29   3.2  
AF025458-5|AAB70974.1|  298|Caenorhabditis elegans Squat protein...    29   3.2  
AC006743-4|AAF60502.1|  291|Caenorhabditis elegans Collagen prot...    29   3.2  
Z74472-4|CAA98942.1|  301|Caenorhabditis elegans Hypothetical pr...    28   4.2  
Z68507-1|CAA92826.1|  337|Caenorhabditis elegans Hypothetical pr...    28   4.2  
Z22964-2|CAA80537.1| 1759|Caenorhabditis elegans a2(IV) collagen...    28   4.2  
Z22964-1|CAA80536.1| 1758|Caenorhabditis elegans a2(IV) collagen...    28   4.2  
V00147-1|CAA23463.1|  296|Caenorhabditis elegans protein ( Caeno...    28   4.2  
U53342-4|AAA96216.1| 1758|Caenorhabditis elegans Lethal protein ...    28   4.2  
U53342-3|AAA96215.1| 1759|Caenorhabditis elegans Lethal protein ...    28   4.2  
U22327-1|AAA64312.1| 1795|Caenorhabditis elegans alpha2(IV) coll...    28   4.2  
J01047-1|AAA27988.1|  296|Caenorhabditis elegans protein ( C.ele...    28   4.2  
AF040642-7|AAB94952.1|  329|Caenorhabditis elegans Collagen prot...    28   4.2  
AL110477-13|CAB54337.2|  789|Caenorhabditis elegans Hypothetical...    25   4.8  
AF230279-1|AAG16654.1|  789|Caenorhabditis elegans SWI3-like pro...    25   4.8  
X64435-1|CAA45773.1|  318|Caenorhabditis elegans collagen protein.     28   5.6  
U41624-3|AAF99944.1|  318|Caenorhabditis elegans Dumpy : shorter...    28   5.6  
Z75554-1|CAA99953.3|  681|Caenorhabditis elegans Hypothetical pr...    27   9.8  
Z74043-12|CAA98548.1|  503|Caenorhabditis elegans Hypothetical p...    27   9.8  
Z74040-7|CAA98515.1|  503|Caenorhabditis elegans Hypothetical pr...    27   9.8  
Z74037-4|CAA98490.1|  295|Caenorhabditis elegans Hypothetical pr...    27   9.8  
Z71178-2|CAA94875.1|  297|Caenorhabditis elegans Hypothetical pr...    27   9.8  
U23523-9|AAC46564.1|  147|Caenorhabditis elegans Hypothetical pr...    27   9.8  

>AF100669-1|AAK39265.1|  931|Caenorhabditis elegans Hypothetical
           protein R11E3.3 protein.
          Length = 931

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 33/127 (25%), Positives = 52/127 (40%), Gaps = 5/127 (3%)
 Frame = +2

Query: 47  DIRRVLNCDSRPALLVGDLNAKHVAWGSR-LNSAVGRRLLEDAD-RGDYSVVGPDEPTHI 220
           D   +    S+ +++ GD+NA H AW S       GR L E  D   D  +      T  
Sbjct: 23  DFSNIFQTKSK-SIISGDVNAHHSAWHSEGSEDTRGRELAELIDLHPDLIIQNEQVHTRA 81

Query: 221 PTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPL---RPK 391
            T +   PD+         +C  +   LY LG+ H+P+ + +    T      L     K
Sbjct: 82  DTYSISSPDITICTADLATKCHWS--TLYKLGSDHIPMKLKINQAATPKRPKRLVANFKK 139

Query: 392 VDWELFK 412
            +W+LF+
Sbjct: 140 ANWQLFR 146


>AF026211-4|AAB71295.1|  416|Caenorhabditis elegans Collagen protein
           40 protein.
          Length = 416

 Score = 31.9 bits (69), Expect = 0.34
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = +1

Query: 313 GYPPSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRP 429
           G  P+  PG  G   +PG D AP   G  G + ETP  P
Sbjct: 206 GEGPAGPPGPPGPAGNPGTDGAPGNPGAPGQVTETPGTP 244


>AL022716-5|CAB97232.1|  291|Caenorhabditis elegans Hypothetical
           protein C24F3.6 protein.
          Length = 291

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 310 PGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSRN 438
           PG P  P  PG  G    PG D +P  +G  GA  E P +P R+
Sbjct: 210 PGEPGQPGQPGQRGPAGEPGKDGSPGGQGEKGASGE-PGQPGRD 252


>AF022985-12|AAB69959.1|  319|Caenorhabditis elegans Collagen
           protein 143 protein.
          Length = 319

 Score = 31.5 bits (68), Expect = 0.46
 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 2/47 (4%)
 Frame = +1

Query: 298 GTVRPGYPPSP--YPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPS 432
           GT  P  PP P   PGH+GN   PG    P   G   A    P+R S
Sbjct: 229 GTPGPQGPPGPSGQPGHSGNDGVPGTPGNPGAPGGDAAYCPCPARSS 275


>L15419-1|AAA17726.1|  308|Caenorhabditis elegans col-40 collagen
           protein.
          Length = 308

 Score = 31.1 bits (67), Expect = 0.60
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +1

Query: 307 RPGYPPSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRP 429
           R G   +  PG  G   +PG D AP   G  G + ETP  P
Sbjct: 194 RGGVGEAGPPGPPGTSGNPGTDGAPGNPGAPGQVTETPGTP 234


>Z99281-6|CAB54458.2|  625|Caenorhabditis elegans Hypothetical
           protein Y57G11C.9b protein.
          Length = 625

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = -1

Query: 207 SSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAGRLSQFRTR 55
           S+ P        + S SR P+   SR    +    +SP SR GR+S+ R+R
Sbjct: 160 SASPPVRRGRSKSRSRSRSPSRSRSRSRSRSVSRSKSPASRNGRVSRHRSR 210


>Z99281-5|CAB54457.1|  553|Caenorhabditis elegans Hypothetical
           protein Y57G11C.9a protein.
          Length = 553

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = -1

Query: 207 SSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAGRLSQFRTR 55
           S+ P        + S SR P+   SR    +    +SP SR GR+S+ R+R
Sbjct: 160 SASPPVRRGRSKSRSRSRSPSRSRSRSRSRSVSRSKSPASRNGRVSRHRSR 210


>AL032632-7|CAA21586.1|  313|Caenorhabditis elegans Hypothetical
           protein Y11D7A.11 protein.
          Length = 313

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%)
 Frame = +1

Query: 310 PGYPPSP--YPGHTGNGAHPGCDLAPTTEGRLG 402
           P  PP P   PG  GN   PG D  P   GR G
Sbjct: 170 PAGPPGPPGNPGPQGNSGRPGMDGMPGRNGRCG 202


>Z78418-5|CAB01694.2|  361|Caenorhabditis elegans Hypothetical
           protein F25D7.2 protein.
          Length = 361

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +1

Query: 328 PYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRP 429
           P+  +  NG + G + APTTEG   A  + P  P
Sbjct: 291 PHVNNNNNGENDGDNTAPTTEGETPATSDAPVEP 324


>Z82083-5|CAB04973.1|  298|Caenorhabditis elegans Hypothetical
           protein ZK1010.7 protein.
          Length = 298

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYP-PSPYPGHTGNGAHPGCDLAPTTEGRLG 402
           PG P PS  PG  G    PG D AP  +G  G
Sbjct: 220 PGEPGPSGLPGDQGQAGRPGSDGAPGPQGPPG 251


>U41994-9|AAK31523.1|  786|Caenorhabditis elegans Hypothetical
           protein F59A6.3 protein.
          Length = 786

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 37/149 (24%), Positives = 55/149 (36%), Gaps = 3/149 (2%)
 Frame = -1

Query: 462 PSGVLGS*IAGRSTRRLLKSSQSTFGRRGEVATRVSPIPSVTRIGRWGVPRSYSASIVKG 283
           PS   GS ++  S         +T G      +  S  P  T      +  + SAS   G
Sbjct: 421 PSTTSGSTVSDTSGPSTTSGPSTTLGTTQSTTSGPSTTPGST------ISTTSSASTTSG 474

Query: 282 HRSPL*THTSNTSGWSCAAVGMCVGSSGPTTE*SPLSASSNSRLPTA--EFSREPHATCF 109
             +   +  S TSG S ++      +SGPTT   P + S  +   T+    +  P  T  
Sbjct: 475 PSTSSGSTVSTTSGQSTSSGTTKSTTSGPTTSSGPSTVSERTLSTTSGPSTTSGPSTTSG 534

Query: 108 ALRSPTSRAGRLS-QFRTRLMSPG*KSGP 25
           +  S T  A   S   ++    P   SGP
Sbjct: 535 STVSTTPGASTTSGSTQSTTSGPSTSSGP 563


>AF022985-10|AAB69961.1|  325|Caenorhabditis elegans Collagen
           protein 142 protein.
          Length = 325

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +1

Query: 298 GTVRPGYPPSP--YPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSR 426
           G+  P  PP P   PGH+GN   PG    P + G   A    P+R
Sbjct: 229 GSPGPQGPPGPSGQPGHSGNDGVPGAPGNPGSPGGDAAYCPCPAR 273


>AF022985-9|AAB69960.1|  314|Caenorhabditis elegans Collagen protein
           141 protein.
          Length = 314

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 1/36 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLG 402
           G+  PG P +P  PGH G    PG   AP   G  G
Sbjct: 234 GSGTPGQPGAPGAPGHPGQAGTPGTPGAPGNSGAPG 269


>U53332-11|AAK31531.1|  668|Caenorhabditis elegans Protein tyrosine
           phosphatase protein2 protein.
          Length = 668

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +3

Query: 378 PYDRRSTGSSLRDA*STFPQFRTPTP--LRGSTTRQSALSTPSGERSTRRRLLCPAAGPE 551
           PY  +S      DA   FP+   PTP   R S+ RQ   S PS   S+R     P  GP+
Sbjct: 586 PYPVKSFIDGDTDA-FDFPRRLRPTPNASRPSSARQVTSSRPSSSASSRTSHSRPRTGPQ 644

Query: 552 VYSRPI*KR 578
             + PI +R
Sbjct: 645 --AEPIFER 651


>S47168-2|AAB23866.2|  919|Caenorhabditis elegans UNC-5 protein.
          Length = 919

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 21/53 (39%), Positives = 27/53 (50%)
 Frame = +3

Query: 360 PGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTR 518
           PG+R R       G+ L +  S+  Q+  P PL  STT +S  S  SG  STR
Sbjct: 392 PGVR-RLLLEHQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTR 443


>S47168-1|AAB23867.2|  947|Caenorhabditis elegans UNC-5 protein.
          Length = 947

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 21/53 (39%), Positives = 27/53 (50%)
 Frame = +3

Query: 360 PGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTR 518
           PG+R R       G+ L +  S+  Q+  P PL  STT +S  S  SG  STR
Sbjct: 420 PGVR-RLLLEHQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTR 471


>AF036698-5|AAB88356.2|  567|Caenorhabditis elegans Uncoordinated
           protein 5, isoform b protein.
          Length = 567

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 21/53 (39%), Positives = 27/53 (50%)
 Frame = +3

Query: 360 PGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTR 518
           PG+R R       G+ L +  S+  Q+  P PL  STT +S  S  SG  STR
Sbjct: 392 PGVR-RLLLEHQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTR 443


>AF036698-4|AAB88355.1|  919|Caenorhabditis elegans Uncoordinated
           protein 5, isoform a protein.
          Length = 919

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 21/53 (39%), Positives = 27/53 (50%)
 Frame = +3

Query: 360 PGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTR 518
           PG+R R       G+ L +  S+  Q+  P PL  STT +S  S  SG  STR
Sbjct: 392 PGVR-RLLLEHQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTR 443


>AF015882-1|AAC21678.1|  668|Caenorhabditis elegans protein tyrosine
           phosphatase protein.
          Length = 668

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +3

Query: 378 PYDRRSTGSSLRDA*STFPQFRTPTP--LRGSTTRQSALSTPSGERSTRRRLLCPAAGPE 551
           PY  +S      DA   FP+   PTP   R S+ RQ   S PS   S+R     P  GP+
Sbjct: 586 PYPVKSFIDGDTDA-FDFPRRLRPTPNASRPSSARQVTSSRPSSSASSRTSHSRPRTGPQ 644

Query: 552 VYSRPI*KR 578
             + PI +R
Sbjct: 645 --AEPIFER 651


>Z49131-6|CAA88979.1|  297|Caenorhabditis elegans Hypothetical
           protein ZC373.7 protein.
          Length = 297

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = +1

Query: 298 GTVRPGYPPSP--YPGHTGNGAHPGCDLAPTTEGRLGA 405
           G+  P  P  P   PG  G+  HPG    P ++G  GA
Sbjct: 158 GSAGPAGPKGPDGRPGQPGSAGHPGAPGQPGSKGNNGA 195


>AF025458-5|AAB70974.1|  298|Caenorhabditis elegans Squat protein 2
           protein.
          Length = 298

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ET 417
           P  PP P PG  GNG   G      T+G+ G+L E+
Sbjct: 111 PAGPPGP-PGDDGNGGQDGVRGNDGTDGKEGSLLES 145


>AC006743-4|AAF60502.1|  291|Caenorhabditis elegans Collagen protein
           109 protein.
          Length = 291

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGR 396
           G  +PG+P  P  PG  G    PG    P T GR
Sbjct: 91  GCCKPGHPGRPGLPGRNGKPGVPGAPGRPGTPGR 124


>Z74472-4|CAA98942.1|  301|Caenorhabditis elegans Hypothetical
           protein F23H12.4 protein.
          Length = 301

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSPY-PGHTGNGAHPGCDLAPTTEGRLG 402
           PG P +P  PG  G    PG D AP + G  G
Sbjct: 158 PGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRG 189


>Z68507-1|CAA92826.1|  337|Caenorhabditis elegans Hypothetical
           protein M18.1 protein.
          Length = 337

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%)
 Frame = +1

Query: 307 RPGYP-PSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPS 432
           +PG P P  +PG  GN   PG   A    G   A    PSR S
Sbjct: 240 QPGQPGPDGHPGQPGNAGPPGTPGAAGQPGGDAAYCPCPSRSS 282



 Score = 27.5 bits (58), Expect = 7.4
 Identities = 15/35 (42%), Positives = 16/35 (45%)
 Frame = +1

Query: 298 GTVRPGYPPSPYPGHTGNGAHPGCDLAPTTEGRLG 402
           GT     P  P PG  GN   PG D AP   G+ G
Sbjct: 212 GTAGSPGPQGP-PGQNGNDGQPGNDGAPGQPGQPG 245


>Z22964-2|CAA80537.1| 1759|Caenorhabditis elegans a2(IV) collagen
           protein.
          Length = 1759

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLG 402
           PG P SP +PG  G+   PG    P  EG+ G
Sbjct: 823 PGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRG 854



 Score = 27.9 bits (59), Expect = 5.6
 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLGAL*ET 417
           GT   G P  P  PG  GN   PG D  P   G  G +  T
Sbjct: 361 GTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNT 401


>Z22964-1|CAA80536.1| 1758|Caenorhabditis elegans a2(IV) collagen
           protein.
          Length = 1758

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLG 402
           PG P SP +PG  G+   PG    P  EG+ G
Sbjct: 822 PGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRG 853



 Score = 27.9 bits (59), Expect = 5.6
 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLGAL*ET 417
           GT   G P  P  PG  GN   PG D  P   G  G +  T
Sbjct: 360 GTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNT 400


>V00147-1|CAA23463.1|  296|Caenorhabditis elegans protein (
           Caenorhabditis elegansgene Col-1 coding for a collagen.
           ).
          Length = 296

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSPY-PGHTGNGAHPGCDLAPTTEGRLG 402
           PG P +P  PG  G    PG D AP + G  G
Sbjct: 153 PGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRG 184


>U53342-4|AAA96216.1| 1758|Caenorhabditis elegans Lethal protein 2,
           isoform a protein.
          Length = 1758

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLG 402
           PG P SP +PG  G+   PG    P  EG+ G
Sbjct: 822 PGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRG 853



 Score = 27.9 bits (59), Expect = 5.6
 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLGAL*ET 417
           GT   G P  P  PG  GN   PG D  P   G  G +  T
Sbjct: 360 GTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNT 400


>U53342-3|AAA96215.1| 1759|Caenorhabditis elegans Lethal protein 2,
           isoform b protein.
          Length = 1759

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLG 402
           PG P SP +PG  G+   PG    P  EG+ G
Sbjct: 823 PGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRG 854



 Score = 27.9 bits (59), Expect = 5.6
 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLGAL*ET 417
           GT   G P  P  PG  GN   PG D  P   G  G +  T
Sbjct: 361 GTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNT 401


>U22327-1|AAA64312.1| 1795|Caenorhabditis elegans alpha2(IV)
           collagen protein.
          Length = 1795

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLG 402
           PG P SP +PG  G+   PG    P  EG+ G
Sbjct: 859 PGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRG 890



 Score = 27.9 bits (59), Expect = 5.6
 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLGAL*ET 417
           GT   G P  P  PG  GN   PG D  P   G  G +  T
Sbjct: 397 GTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNT 437


>J01047-1|AAA27988.1|  296|Caenorhabditis elegans protein (
           C.elegans (nematode)collagen 1 (col-1) gene, complete
           cds. ).
          Length = 296

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 PGYPPSPY-PGHTGNGAHPGCDLAPTTEGRLG 402
           PG P +P  PG  G    PG D AP + G  G
Sbjct: 153 PGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRG 184


>AF040642-7|AAB94952.1|  329|Caenorhabditis elegans Collagen protein
           68 protein.
          Length = 329

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 14/32 (43%), Positives = 15/32 (46%)
 Frame = +1

Query: 307 RPGYPPSPYPGHTGNGAHPGCDLAPTTEGRLG 402
           +PG P S  PG  G    PG D AP   G  G
Sbjct: 272 QPGAPGSSQPGPQGPPGDPGIDGAPGNPGSPG 303


>AL110477-13|CAB54337.2|  789|Caenorhabditis elegans Hypothetical
           protein Y113G7B.23 protein.
          Length = 789

 Score = 25.4 bits (53), Expect(2) = 4.8
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 313 GYPPSPYPGH 342
           GYPP P PGH
Sbjct: 733 GYPPPPQPGH 742



 Score = 21.0 bits (42), Expect(2) = 4.8
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 307 RPGYPPSPYPG 339
           RP Y   PYPG
Sbjct: 712 RPPYQAQPYPG 722


>AF230279-1|AAG16654.1|  789|Caenorhabditis elegans SWI3-like
           protein protein.
          Length = 789

 Score = 25.4 bits (53), Expect(2) = 4.8
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 313 GYPPSPYPGH 342
           GYPP P PGH
Sbjct: 733 GYPPPPQPGH 742



 Score = 21.0 bits (42), Expect(2) = 4.8
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 307 RPGYPPSPYPG 339
           RP Y   PYPG
Sbjct: 712 RPPYQAQPYPG 722


>X64435-1|CAA45773.1|  318|Caenorhabditis elegans collagen protein.
          Length = 318

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 11/23 (47%), Positives = 12/23 (52%)
 Frame = +1

Query: 334 PGHTGNGAHPGCDLAPTTEGRLG 402
           PG TG   HPG    P   GR+G
Sbjct: 161 PGQTGESGHPGLPGRPGKPGRVG 183


>U41624-3|AAF99944.1|  318|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 7 protein.
          Length = 318

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 11/23 (47%), Positives = 12/23 (52%)
 Frame = +1

Query: 334 PGHTGNGAHPGCDLAPTTEGRLG 402
           PG TG   HPG    P   GR+G
Sbjct: 161 PGQTGESGHPGLPGRPGKPGRVG 183


>Z75554-1|CAA99953.3|  681|Caenorhabditis elegans Hypothetical
           protein ZC455.1 protein.
          Length = 681

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 30/97 (30%), Positives = 39/97 (40%), Gaps = 4/97 (4%)
 Frame = -1

Query: 357 SPIPSVTRIGRWGVPRSYSASIVKGHR-SPL*THTSNTSGWSCAAVGMCVGSSG--PTT- 190
           +PI  V     WG P  Y +S+   +R SP   ++ NTS  S  +V          PTT 
Sbjct: 9   TPIKMVGSQDSWGTPPHYRSSLNSNYRDSP--ANSRNTSARSRLSVSSAQSPHCFLPTTR 66

Query: 189 E*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAG 79
           + SP S  S S +P    S           SP S  G
Sbjct: 67  DSSPRSIPSPSLVPMRPDSSSDITINELHHSPLSHTG 103


>Z74043-12|CAA98548.1|  503|Caenorhabditis elegans Hypothetical
           protein T19B10.1 protein.
          Length = 503

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%)
 Frame = +3

Query: 291 LLRHCTTWVPPISLSWSHWEWGS--PGLRPRP 380
           +L +  TW+P +     HW++GS  PG    P
Sbjct: 12  ILAYLATWIPTLLKYKRHWQYGSKLPGPPAHP 43


>Z74040-7|CAA98515.1|  503|Caenorhabditis elegans Hypothetical
           protein T19B10.1 protein.
          Length = 503

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%)
 Frame = +3

Query: 291 LLRHCTTWVPPISLSWSHWEWGS--PGLRPRP 380
           +L +  TW+P +     HW++GS  PG    P
Sbjct: 12  ILAYLATWIPTLLKYKRHWQYGSKLPGPPAHP 43


>Z74037-4|CAA98490.1|  295|Caenorhabditis elegans Hypothetical
           protein F57B7.3 protein.
          Length = 295

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = +1

Query: 298 GTVRPGYPPSP-YPGHTGNGAHPGCDLAPTTEGRLGA 405
           G   PG P +P   G  GN   PG D AP   G  GA
Sbjct: 201 GRGTPGAPGAPGAAGAPGNNGQPGQDGAPGQAGAPGA 237


>Z71178-2|CAA94875.1|  297|Caenorhabditis elegans Hypothetical
           protein B0024.2 protein.
          Length = 297

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = +1

Query: 307 RPGYP-PSPYPGHTGNGAHPGCDLAPTTEGRLG 402
           RPG P P    GH G    PG    P  +GR G
Sbjct: 183 RPGQPAPQGNAGHPGRDGEPGQPGNPGKDGRKG 215


>U23523-9|AAC46564.1|  147|Caenorhabditis elegans Hypothetical
           protein F53A9.9 protein.
          Length = 147

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 15/32 (46%), Positives = 15/32 (46%)
 Frame = +1

Query: 271 GATVPLNY*GTVRPGYPPSPYPGHTGNGAHPG 366
           G T P    G    GY PSP  G  GNG  PG
Sbjct: 80  GYTGPTAGTGFGNAGYTPSPPAGVPGNGFVPG 111


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,070,441
Number of Sequences: 27780
Number of extensions: 363366
Number of successful extensions: 1261
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 1058
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1257
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1226509528
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).