SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       54   1e-09
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    24   1.3  
AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective...    23   2.4  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    22   5.4  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    22   7.2  
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        21   9.5  
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    21   9.5  
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    21   9.5  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                21   9.5  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 54.0 bits (124), Expect = 1e-09
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 9/109 (8%)
 Frame = +1

Query: 1   GKTATFSISIL-----QQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F++ I+     + +D  +     E Q +I++PTREL  QI + ++    +   K 
Sbjct: 245 GKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNSILKT 304

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL 300
               GGT+V     +L +G H++V TPGR+ D +   R   +   FL L
Sbjct: 305 VVAYGGTSVMHQRGKLSAGCHILVATPGRLLDFVEKGRVKFSSVQFLVL 353



 Score = 38.7 bits (86), Expect = 6e-05
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 4/61 (6%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVF----KILSADVQVILLSATMPDDVLEVSRCFMR 443
           ++++  VLDEAD ML  GF   I  +      +   + Q ++ SAT PD+V  ++R F+ 
Sbjct: 346 SSVQFLVLDEADRMLDMGFLPSIEKMVDHETMVPLGERQTLMFSATFPDEVQHLARRFLN 405

Query: 444 D 446
           +
Sbjct: 406 N 406


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 10/38 (26%), Positives = 18/38 (47%)
 Frame = +1

Query: 391 SLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF 504
           +++ C M  +  +     I Y ++  R  LPW   NN+
Sbjct: 67  AVMSCWMNVYYIVILAWAIFYFFMSMRSELPWGSCNNY 104


>AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective
           protein-1 protein.
          Length = 128

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -3

Query: 181 GHWCHQCKHGI*HSS 137
           G  CH+CK+GI  SS
Sbjct: 40  GDSCHKCKYGIAMSS 54


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = +3

Query: 159 LHWWHQCP 182
           LH WH CP
Sbjct: 470 LHHWHHCP 477


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
            protein.
          Length = 1124

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 655  RYSKVTQMHRFSEPIPP 605
            +Y K+  +H  + P+PP
Sbjct: 1096 KYGKLVMIHEENAPLPP 1112


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -2

Query: 335 LETSGQHFISFIKNKKFDGVGM 270
           L+    H I+ I +K F GVG+
Sbjct: 120 LQVFRDHLINQIPDKSFPGVGV 141


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 10/26 (38%), Positives = 18/26 (69%), Gaps = 1/26 (3%)
 Frame = +1

Query: 349 MSSRFCQLMFKSY-YSLLPCLMMYWK 423
           + S+ C +  +SY Y++L  ++MYWK
Sbjct: 170 LDSQNCTVEIESYGYTVLD-VVMYWK 194


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic
          acetylcholine receptor beta1subunit protein.
          Length = 520

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +2

Query: 2  EKLLLSLYRFYNKSIQAFVNV 64
          E+L+  L+R YNK I+   N+
Sbjct: 28 ERLVRDLFRGYNKLIRPVQNM 48


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 7/18 (38%), Positives = 8/18 (44%)
 Frame = -3

Query: 226 PPPHEHHSPVGEYLHGHW 173
           PP H HH       H H+
Sbjct: 349 PPHHHHHHQTQSLQHLHY 366


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,100
Number of Sequences: 438
Number of extensions: 5676
Number of successful extensions: 19
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23911269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).