SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0016
         (598 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    25   0.75 
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    22   5.3  
DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex det...    21   6.9  
DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex det...    21   6.9  
DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex det...    21   6.9  
DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex det...    21   6.9  
DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex det...    21   6.9  
DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex det...    21   6.9  
DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex det...    21   6.9  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          21   6.9  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          21   6.9  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          21   6.9  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          21   6.9  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          21   6.9  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          21   6.9  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    21   6.9  
S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating...    21   9.2  

>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 24.6 bits (51), Expect = 0.75
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +1

Query: 331 NYVEKNKYDNIVVLDHSFA 387
           NY E+NK D IV+L  +++
Sbjct: 284 NYAEENKRDEIVLLTEAYS 302


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 11/35 (31%), Positives = 16/35 (45%)
 Frame = +2

Query: 227 NSYRHLKKKCLHYSQCYNSME*HSQLNKYRRKRHI 331
           N+      KC   S  Y++ + HSQL    R  H+
Sbjct: 356 NTLERTPSKCSQTSVHYSNGQTHSQLCPTPRSTHL 390


>DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 10  REYKKKDRRYDQLHNVEEKHLRERTSRRR 38


>DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 10  REYKKKDRRYDQLHNVEEKHLRERTSRRR 38


>DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 10  REYKKKDRRYDQLHNVEEKHLRERTSRRR 38


>DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 10  REYKKKDRRYDQLHNVEEKHLRERTSRRR 38


>DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 10  REYKKKDRRYDQLHNVEEKHLRERTSRRR 38


>DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 10  REYKKKDRRYDQLHNVEEKHLRERTSRRR 38


>DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 10  REYKKKDRRYDQLHNVEEKHLRERTSRRR 38


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 236 RHLKKKCLHYSQCYNSME*HSQLNKYRRK 322
           R  KKK   Y Q +N  E H +    RR+
Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRERTSRRR 287


>S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating
           peptide protein.
          Length = 50

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 161 FFIAVILVIQYF 126
           FF++VIL+  YF
Sbjct: 10  FFLSVILITSYF 21


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 138,202
Number of Sequences: 438
Number of extensions: 2508
Number of successful extensions: 20
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17482179
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).