SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    24   1.2  
AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase ...    24   1.6  
AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.          24   1.6  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                24   1.6  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    22   6.4  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   6.4  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   6.4  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    22   6.4  
AB208108-1|BAE72140.1|   92|Apis mellifera Broad complex zinc fi...    21   8.5  

>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = +1

Query: 586 PPIRKTTDCPFLTDFSSALGDLV 654
           PPIRK +DC   +  S    D+V
Sbjct: 418 PPIRKISDCSTTSSLSGDESDVV 440


>AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase
           protein.
          Length = 510

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -2

Query: 292 DCVVRGRREQIGIIPIFTNPRFFKRSAELGLVA 194
           DC+     E +G +P+  +P F + S E+GL +
Sbjct: 335 DCI----HELLGHMPLLADPSFAQFSQEIGLAS 363


>AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.
          Length = 148

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 8   GAIGPIGANSVSSGLSWEQHPVLSRASSVPAHRALAGLL 124
           G+ GP   N VS  +SWE H  ++ + +      + GL+
Sbjct: 38  GSYGPEAGN-VSCSVSWEVHDPVTNSDTYIGFLFVLGLI 75


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 524 LSTCDVATSTGHSFRFSPHEL 586
           L+ C   +STG S  FSP EL
Sbjct: 21  LTQCLQESSTGQSVEFSPMEL 41


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 10/34 (29%), Positives = 19/34 (55%)
 Frame = -2

Query: 658 DERDRREPMKSRLKTGSRSSSGSGEFVRRKAKAV 557
           +ER+ ++  K    TG+  S G  E  +R +K++
Sbjct: 353 EEREAQKSQKPSPVTGASKSHGDLELRQRSSKSL 386


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%)
 Frame = +2

Query: 422 QEVHWHRSHRA---DLWRRI*ATGR-DRHARRISIDASLSTCDVATSTGHSFRFS 574
           +E+ W R++R    DL +++   G     + +   DA + TC      GHS R S
Sbjct: 548 EEIKWERANRELPDDLRQKVLPDGTLVITSVQKKGDAGVYTCSARNKQGHSARRS 602


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%)
 Frame = +2

Query: 422 QEVHWHRSHRA---DLWRRI*ATGR-DRHARRISIDASLSTCDVATSTGHSFRFS 574
           +E+ W R++R    DL +++   G     + +   DA + TC      GHS R S
Sbjct: 548 EEIKWERANRELPDDLRQKVLPDGTLVITSVQKKGDAGVYTCSARNKQGHSARRS 602


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = +3

Query: 156 PPVNRLLRHQPQVATRPSSADRL 224
           PP   LLR+   +AT P    +L
Sbjct: 827 PPTPNLLRYFASIATNPKEQAQL 849


>AB208108-1|BAE72140.1|   92|Apis mellifera Broad complex zinc
           finger domain-Z3 isoform protein.
          Length = 92

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +1

Query: 166 TGSSATSHKSLQDR 207
           T +S T+HKSLQ R
Sbjct: 47  TKNSLTTHKSLQHR 60


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,973
Number of Sequences: 438
Number of extensions: 3744
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).