SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    23   3.4  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              23   3.4  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                23   3.4  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    22   4.5  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    22   6.0  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    22   6.0  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   6.0  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   6.0  

>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +1

Query: 43  MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 177
           M  C P   DT    +Y+F   R Y +   T VI  +   + TLT
Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/27 (33%), Positives = 17/27 (62%)
 Frame = +2

Query: 458 RHGR**RKITIRDSYEARNRNEYTLNI 538
           +H R  R  T+ +SY+A + N  +L++
Sbjct: 29  KHSRRHRDFTVAESYDASSSNSDSLSM 55


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 21/86 (24%), Positives = 32/86 (37%)
 Frame = -1

Query: 521 HSDYGPRKSPVSLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNLDSPLPVTTMVVA 342
           H+  G R S  +    TTS  GSG          V  V  + S   N D+ L +   +  
Sbjct: 217 HAQMG-RPSYTTATMATTSTPGSGSLPASPADSGVSDVESSTSSGGNEDANLLLKARLNP 275

Query: 341 ETTIES**GRHLKDASPVLDHAICKS 264
            ++++     H    S  L  + C S
Sbjct: 276 NSSLQPSLASHHSHLSSALGRSACHS 301


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = +3

Query: 15  YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 128
           Y C  +    +     LRR   +  ++++VP + +SYL
Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/38 (18%), Positives = 21/38 (55%)
 Frame = +3

Query: 15  YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 128
           Y C  +  + ++    +RR   +  +++++P + +S+L
Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/38 (18%), Positives = 21/38 (55%)
 Frame = +3

Query: 15  YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 128
           Y C  +  + ++    +RR   +  +++++P + +S+L
Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +3

Query: 429  RQQARKLPTPGTGGSDE 479
            R+Q RK  TPG   SDE
Sbjct: 1768 RRQQRKQQTPGDVESDE 1784


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +3

Query: 429  RQQARKLPTPGTGGSDE 479
            R+Q RK  TPG   SDE
Sbjct: 1764 RRQQRKQQTPGDVESDE 1780


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,681
Number of Sequences: 438
Number of extensions: 4307
Number of successful extensions: 11
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).