SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    24   1.00 
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    22   4.0  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    22   4.0  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   7.0  

>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 23.8 bits (49), Expect = 1.00
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = -1

Query: 484 SPASSFE*AGVLTHLKFENRLRSFRPKCL*SCALPDETVLKFYIDASYPEGN 329
           S A+S E   + TH +  ++LR  R     S  L DE   K +  ++  EGN
Sbjct: 220 STAASDEDISLTTHQQKRHKLRVTRCYSSDSAVLSDEDQTKGWDGSNMVEGN 271


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 4.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 292 LSPLYPVPTID 260
           LSP+YP P +D
Sbjct: 71  LSPIYPSPMVD 81


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 4.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 292 LSPLYPVPTID 260
           LSP+YP P +D
Sbjct: 71  LSPIYPSPMVD 81



 Score = 20.6 bits (41), Expect = 9.3
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = -2

Query: 279 TQFRRSICSQNRYGPPSGFP 220
           + F++ I +   Y PPSG P
Sbjct: 321 SDFKKLIDNWMTYMPPSGIP 340


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = +3

Query: 294 LIEPSSSWVRPKFPS 338
           + EP  S VRPKFPS
Sbjct: 202 ITEPVGS-VRPKFPS 215


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,437
Number of Sequences: 438
Number of extensions: 3050
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13421061
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).