SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.    25   0.70 
EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2 prot...    25   0.70 
AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2 prot...    25   0.70 
EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate isome...    23   3.7  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          22   6.5  

>X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.
          Length = 162

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -3

Query: 399 HLVTGCAKRSSG*CDHH 349
           H VTGC +R+ G C H+
Sbjct: 128 HPVTGCGERTEGRCLHY 144


>EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -3

Query: 399 HLVTGCAKRSSG*CDHH 349
           H VTGC +R+ G C H+
Sbjct: 133 HPVTGCGERTEGRCLHY 149


>AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -3

Query: 399 HLVTGCAKRSSG*CDHH 349
           H VTGC +R+ G C H+
Sbjct: 133 HPVTGCGERTEGRCLHY 149


>EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate
           isomerase protein.
          Length = 247

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 3/24 (12%)
 Frame = +3

Query: 402 GKPSDVL---TKAVEKDFGSWDNI 464
           GK  +V+   TKA+     SWDN+
Sbjct: 136 GKTDEVVFRQTKAIANKINSWDNV 159


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 3/55 (5%)
 Frame = +3

Query: 162 ELPYEYNALEP---VISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           +LP E     P   ++   I  L    HH+T I N +  + K          DTI
Sbjct: 291 DLPPETQPTPPSATLVGTTITHLRDPDHHSTDIQNCDSVKIKFETLHTMDSSDTI 345


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 240,922
Number of Sequences: 438
Number of extensions: 5678
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28662543
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).