BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0068 (532 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 40 1e-05 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 33 0.002 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.5 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 4.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 5.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.9 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 40.3 bits (90), Expect = 1e-05 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 5/93 (5%) Frame = -2 Query: 531 DYIAPEVFFQDWVRPLQRTGEASGVIMYEMLIGYPPFLLRITPGDDRK----VMSWRESL 364 +Y+APEV + + GV+M+E+L G PPF T GD K ++ +++ Sbjct: 530 EYVAPEVILNKG-HDISADYWSLGVLMFELLTGTPPF----TGGDPMKTYNIILKGIDAI 584 Query: 363 TFPPEVPISEEARETILRFCSE-PDRRLGSQRG 268 FP I+ A I + C + P RLG Q+G Sbjct: 585 EFPRS--ITRNATALIKKLCRDNPAERLGYQKG 615 Score = 28.7 bits (61), Expect = 0.039 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -1 Query: 244 FFRGVDWSHVRERPAA--ISVEVRSIDDTSNFDDFP 143 +F G +W +R R I V++ DT+NFD++P Sbjct: 625 WFDGFNWEGLRARTLEPPIMPRVQNATDTTNFDEYP 660 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 32.7 bits (71), Expect = 0.002 Identities = 16/37 (43%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -2 Query: 528 YIAPEVFFQD-WVRPLQRTGEASGVIMYEMLIGYPPF 421 Y++PEV ++ + +P+ A GVI+Y +L+GYPPF Sbjct: 78 YLSPEVLKKEPYGKPVDIW--ACGVILYILLVGYPPF 112 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 149 IVEVGCVVYGAHFYGYSRRPLPDVRPVD 232 +V++ V+G H Y P +PVD Sbjct: 628 VVQIDSPVWGRHIYDGRAMGFPLDKPVD 655 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +3 Query: 288 CDRVPNRNAISSLSLPR*WEPR 353 CDR+ I S+ W+PR Sbjct: 1664 CDRIKRGTVIRSIRSHSTWDPR 1685 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 149 IVEVGCVVYGAHFYGYSRRPLPDVRPVD 232 +V++ V+G H Y P +PVD Sbjct: 628 VVQIDSPVWGRHIYDGRAMGFPLDKPVD 655 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 376 PGHNFSVVSWGDSEQKRRVADQHFVHNDPRG 468 P +N+ V WG + Q Q+++H G Sbjct: 160 PPNNWLSVFWGSAWQWNEERKQYYLHQFATG 190 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 463 GGHYVRNADRLPAVFAPNHP 404 GG +VR+ P V+ N P Sbjct: 89 GGQFVRDLIWTPTVYVSNEP 108 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/29 (24%), Positives = 15/29 (51%) Frame = -2 Query: 522 APEVFFQDWVRPLQRTGEASGVIMYEMLI 436 +P+ F W+ PL+ G + +Y ++ Sbjct: 1226 SPQALFISWLPPLEPNGIITKYNLYTRVV 1254 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/29 (24%), Positives = 15/29 (51%) Frame = -2 Query: 522 APEVFFQDWVRPLQRTGEASGVIMYEMLI 436 +P+ F W+ PL+ G + +Y ++ Sbjct: 1222 SPQALFISWLPPLEPNGIITKYNLYTRVV 1250 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,824 Number of Sequences: 438 Number of extensions: 3431 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -