SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    26   0.28 
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    24   0.84 
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    24   0.84 
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          24   1.1  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      24   1.1  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   1.9  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    22   4.5  

>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 25.8 bits (54), Expect = 0.28
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +3

Query: 51  FMNL*TTRFPTAGHLSQCTPMILVAPFSLCRERGETRWL 167
           +++  T  F T+   + C   ++V PFS   E  E RWL
Sbjct: 75  YLHTATNYFVTSLAFADCLVGLVVMPFSAIYEVLENRWL 113


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 24.2 bits (50), Expect = 0.84
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -1

Query: 216 GHAVGDIPGVRFKVVKVANVSLL 148
           GH V D+PGVR +V++   + LL
Sbjct: 69  GHPVNDVPGVR-RVLRNGTLVLL 90


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 24.2 bits (50), Expect = 0.84
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -1

Query: 216 GHAVGDIPGVRFKVVKVANVSLL 148
           GH V D+PGVR +V++   + LL
Sbjct: 69  GHPVNDVPGVR-RVLRNGTLVLL 90


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = +1

Query: 370 TPTFSRGGPVPIRPIVSRITIH 435
           T T+S G P P RPI S   I+
Sbjct: 298 TMTYSNGLPFPQRPIWSNFPIY 319


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = +1

Query: 370 TPTFSRGGPVPIRPIVSRITIH 435
           T T+S G P P RPI S   I+
Sbjct: 298 TMTYSNGLPFPQRPIWSNFPIY 319


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = -1

Query: 216 GHAVGDIPGVR 184
           G AVGD+PG+R
Sbjct: 42  GSAVGDVPGLR 52


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -2

Query: 356 PNSAIRKCV 330
           PNSA+RKC+
Sbjct: 584 PNSAVRKCM 592


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,152
Number of Sequences: 438
Number of extensions: 3168
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14968302
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).