SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g26130.1 68418.m03108 pathogenesis-related protein, putative ...    32   0.18 
At2g32140.1 68415.m03928 disease resistance protein (TIR class),...    31   0.54 
At1g31370.1 68414.m03839 expressed protein ; expression supporte...    29   1.3  
At4g10350.1 68417.m01700 no apical meristem (NAM) family protein...    29   1.7  
At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ...    28   2.9  
At1g60770.1 68414.m06841 pentatricopeptide (PPR) repeat-containi...    28   2.9  
At5g08010.1 68418.m00932 expressed protein condensin subunit SMC...    28   3.8  
At4g16390.1 68417.m02481 chloroplastic RNA-binding protein P67, ...    28   3.8  
At4g03430.1 68417.m00470 pre-mRNA splicing factor-related simila...    28   3.8  
At5g19560.1 68418.m02329 hypothetical protein contains Pfam prof...    27   8.9  
At2g18730.1 68415.m02181 diacylglycerol kinase, putative contain...    27   8.9  

>At5g26130.1 68418.m03108 pathogenesis-related protein, putative
           similar to PR-1a protein [Nicotiana tabacum] GI:19944;
           contains Pfam profile PF00188: SCP-like extracellular
           protein
          Length = 164

 Score = 32.3 bits (70), Expect = 0.18
 Identities = 24/85 (28%), Positives = 36/85 (42%)
 Frame = -3

Query: 351 AVPRRGAKLNARSTSILVRGASLGNGDSVXSNAIAVLIWVWRLTDHLTTASNGSDSSSRG 172
           A  R+G      S S  + G +L       S A AV +WV   +D++  ++  SD    G
Sbjct: 62  AQQRKGDCSLTHSNSNGLYGENLAWSGGALSGAEAVKLWVNEKSDYIYASNTCSDGKQCG 121

Query: 171 TEYSTTCRTARRAYSKARMACDTGG 97
                  RT+      A++ CD GG
Sbjct: 122 HYTQVVWRTSEWV-GCAKVKCDNGG 145


>At2g32140.1 68415.m03928 disease resistance protein (TIR class),
           putative domain signature TIR exists, suggestive of a
           disease resistance protein.
          Length = 371

 Score = 30.7 bits (66), Expect = 0.54
 Identities = 36/125 (28%), Positives = 51/125 (40%), Gaps = 3/125 (2%)
 Frame = -3

Query: 453 NTVRTASYNIKRPVAXI-SQHPNHDSEQPP--ELLKTAVPRRGAKLNARSTSILVRGASL 283
           +T+R  S N    V    SQ PN D E      LLK  V    AKL A +TSI+   A L
Sbjct: 242 STMRKVSSNNGVGVGTFKSQKPNFDDEDDDGDSLLKALV----AKLVASTTSIVAAYAEL 297

Query: 282 GNGDSVXSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDT 103
               S    A   ++   +    L  +SNG    S     S+     RR+  + ++  + 
Sbjct: 298 QRAHSDAIQAAETVVVDVKTLSELIRSSNGGGGGSGSGSGSSLENQPRRSKVRKQVWAEV 357

Query: 102 GGKAS 88
            G +S
Sbjct: 358 LGISS 362


>At1g31370.1 68414.m03839 expressed protein ; expression supported
           by MPSS
          Length = 193

 Score = 29.5 bits (63), Expect = 1.3
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -1

Query: 455 KTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCH 342
           K+ FE+   I S   P  P++RTT+ NSL S     CH
Sbjct: 126 KSLFEKHPDIASKFRPKNPHLRTTSLNSLLSLTEILCH 163


>At4g10350.1 68417.m01700 no apical meristem (NAM) family protein
           contains Pfam PF02365: No apical meristem (NAM) domain;
           nap gene, Arabidopsis thaliana, gb:AJ222713
          Length = 341

 Score = 29.1 bits (62), Expect = 1.7
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = -3

Query: 294 GASLGNGDSVXSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEY 163
           G  +G  ++V S+     +  W + D L T   G++ SSRG  Y
Sbjct: 265 GLDVGTCETVASHNHQQGLGEWAMMDRLVTCHMGNEDSSRGITY 308


>At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5
           WD-40 repeats (PF0400);  similar to WD-40 repeat protein
           MSI4 (SP:O22607) [Arabidopsis thaliana]
          Length = 496

 Score = 28.3 bits (60), Expect = 2.9
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -3

Query: 234 VWRLTDHLTTASNGSDSSSRGTEYSTT 154
           +W + DH+T A  GSDS S G+ +  T
Sbjct: 235 LWNIQDHITMA--GSDSKSPGSSFKQT 259


>At1g60770.1 68414.m06841 pentatricopeptide (PPR) repeat-containing
           protein low similarity to DNA-binding protein [Triticum
           aestivum] GI:6958202; contains Pfam profile PF01535: PPR
           repeat
          Length = 491

 Score = 28.3 bits (60), Expect = 2.9
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = -3

Query: 438 ASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILV 298
           ++Y+I+     I  +      Q    LK   PRRG KLNA++  I +
Sbjct: 330 STYDIRIVNVLIGAYAQEGLIQKANELKEKAPRRGGKLNAKTWEIFM 376


>At5g08010.1 68418.m00932 expressed protein condensin subunit SMC4,
           Drosophila melanogaster, EMBL:AF186472
          Length = 566

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +1

Query: 28  SIPKFHSSLQDLKQPSLQEPRCLATRV 108
           ++ K  SS +DL    L+ PRCLA+ V
Sbjct: 21  NVSKGKSSSEDLTNVKLESPRCLASNV 47


>At4g16390.1 68417.m02481 chloroplastic RNA-binding protein P67,
           putative nearly identical to 67kD chloroplastic
           RNA-binding protein, P67 [Arabidopsis thaliana]
           GI:9755842
          Length = 688

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = +1

Query: 298 DEYGRRARVELRSASWHRGLQELWRL----FAVVVRMLGNVGDW 417
           D YGR   V++  + + R   E WR+    F+ ++R+ G  G++
Sbjct: 239 DAYGRAGNVDMALSLYDRARTEKWRIDAVTFSTLIRIYGVSGNY 282


>At4g03430.1 68417.m00470 pre-mRNA splicing factor-related similar
           to pre-mRNA splicing factor pre-mRNA splicing factor
           prp1 (SP:Q12381) [Fission yeast]
          Length = 1029

 Score = 27.9 bits (59), Expect = 3.8
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +1

Query: 313 RARVELRSASWHRGLQELWRLFAVVVRMLGNV 408
           RAR+ L  A    G + +W   A+V R LGNV
Sbjct: 745 RARMLLAKARERGGTERVWMKSAIVERELGNV 776


>At5g19560.1 68418.m02329 hypothetical protein contains Pfam profile
           PF03759: Domain of unknown function (DUF315)
          Length = 493

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = +1

Query: 10  KSSGTSSIPKFHSSLQDLKQPSLQEPRCLATRVTGHARL 126
           K S  S I  FH   Q+ ++P ++ PR L  + +  A+L
Sbjct: 445 KHSSMSDIEFFHKVEQEKEKPMMKSPRALPKKFSYLAKL 483


>At2g18730.1 68415.m02181 diacylglycerol kinase, putative contains
           INTERPRO domain, IPR001206, DAG-kinase catalytic domain
          Length = 488

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%)
 Frame = +2

Query: 287 DAPLTSMDVERALSFAPRRGTAVFKSSGGC---SLSWFGCWEMXATGRLIL 430
           D+P++  D  +    A R  TA  K+  GC   +L+W G  ++    RL++
Sbjct: 2   DSPVSKTDASKEKFVASRPSTADSKTMRGCGLANLAWVGVDKVELRQRLMM 52


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,729,504
Number of Sequences: 28952
Number of extensions: 164735
Number of successful extensions: 547
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 533
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 546
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 838967680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).