SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   130   6e-31
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   130   8e-31
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   130   8e-31
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   128   2e-30
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   128   3e-30
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   128   3e-30
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   124   4e-29
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   124   4e-29
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   124   4e-29
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   114   4e-26
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   110   7e-25
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   110   9e-25
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...    79   3e-15
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    63   2e-10
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    60   2e-09
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    57   9e-09
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    44   8e-05
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    42   3e-04
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.091
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...    34   0.091
At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g...    31   0.64 
At1g59970.1 68414.m06755 matrixin family protein similar to SP|P...    29   2.6  
At3g12650.1 68416.m01575 expressed protein                             28   4.5  
At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t...    28   4.5  
At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t...    28   4.5  
At1g16690.2 68414.m01999 transcription factor-related similar to...    28   4.5  
At1g16690.1 68414.m01998 transcription factor-related similar to...    28   4.5  
At5g06610.1 68418.m00747 expressed protein contains Pfam profile...    27   7.9  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  130 bits (315), Expect = 6e-31
 Identities = 69/128 (53%), Positives = 75/128 (58%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFNTP
Sbjct: 125 MFETFNTP 132



 Score =  121 bits (292), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  130 bits (314), Expect = 8e-31
 Identities = 69/128 (53%), Positives = 75/128 (58%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFNTP
Sbjct: 125 MFETFNTP 132



 Score =  121 bits (291), Expect = 5e-28
 Identities = 52/58 (89%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  130 bits (314), Expect = 8e-31
 Identities = 69/128 (53%), Positives = 75/128 (58%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFNTP
Sbjct: 125 MFETFNTP 132



 Score =  121 bits (291), Expect = 5e-28
 Identities = 52/58 (89%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  128 bits (310), Expect = 2e-30
 Identities = 68/128 (53%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNVP 132



 Score =  121 bits (292), Expect = 3e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  128 bits (309), Expect = 3e-30
 Identities = 68/128 (53%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNAP 132



 Score =  120 bits (290), Expect = 6e-28
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 120


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  128 bits (309), Expect = 3e-30
 Identities = 68/128 (53%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNAP 132



 Score =  120 bits (290), Expect = 6e-28
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 120


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  124 bits (300), Expect = 4e-29
 Identities = 64/128 (50%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN+P
Sbjct: 125 MFETFNSP 132



 Score =  120 bits (290), Expect = 6e-28
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREK 120


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  124 bits (300), Expect = 4e-29
 Identities = 64/128 (50%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN+P
Sbjct: 125 MFETFNSP 132



 Score =  120 bits (290), Expect = 6e-28
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREK 120


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  124 bits (300), Expect = 4e-29
 Identities = 64/128 (50%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN+P
Sbjct: 125 MFETFNSP 132



 Score =  120 bits (290), Expect = 6e-28
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREK 120


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  114 bits (275), Expect = 4e-26
 Identities = 47/58 (81%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL+LKYPIEHG+V+NWDDMEKIWHHTFYNELR+ PEEHP+LLTEA LNPK NREK
Sbjct: 64  RRGILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNREK 121



 Score =  113 bits (272), Expect = 9e-26
 Identities = 59/128 (46%), Positives = 72/128 (56%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VGDEAQ++R
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQARR 65

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+    KMTQI
Sbjct: 66  GILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNREKMTQI 125

Query: 435 MFETFNTP 458
           MFE+F  P
Sbjct: 126 MFESFAFP 133


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  110 bits (265), Expect = 7e-25
 Identities = 52/76 (68%), Positives = 56/76 (73%)
 Frame = +2

Query: 194 RDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 373
           RDG    E  +    G   + ILTLK P+EHGIV NWDDMEKIWH+TFYNELRV PEEHP
Sbjct: 35  RDGLNPNESYVGEE-GHANRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHP 93

Query: 374 VLLTEASLNPKGNREK 421
           VLLTEA  NPK NREK
Sbjct: 94  VLLTEAPYNPKANREK 109



 Score = 74.5 bits (175), Expect = 5e-14
 Identities = 43/123 (34%), Positives = 56/123 (45%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V D G GM +AGFAGD+AP+ VFP +VGRPR      G+   +SYVG+E  + R     
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHANRDILTL 58

Query: 270 XXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETF 449
                           +             P      L   P  P+A   KMTQIMFE+F
Sbjct: 59  KDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHPVLLTEAPYNPKANREKMTQIMFESF 118

Query: 450 NTP 458
           + P
Sbjct: 119 DVP 121


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  110 bits (264), Expect = 9e-25
 Identities = 46/58 (79%), Positives = 53/58 (91%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +  ILTL YP+EHG+V+NWDDMEKIW+HTFY+ELRVAPEEHPVLLTEA LNPK +REK
Sbjct: 18  RSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLNPKADREK 75



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 25/87 (28%), Positives = 33/87 (37%)
 Frame = +3

Query: 198 MVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQS 377
           MVGM + D +VGD+A+++                      +             P     
Sbjct: 1   MVGMNENDLFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPV 60

Query: 378 CLLRLPSTPRATERKMTQIMFETFNTP 458
            L   P  P+A   KMTQIMFETF  P
Sbjct: 61  LLTEAPLNPKADREKMTQIMFETFAVP 87


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score = 78.6 bits (185), Expect = 3e-15
 Identities = 31/60 (51%), Positives = 42/60 (70%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +E +  L + YP+ +GIV NWDDME +W H FYNEL++ P +  +LLT+  LNP  NREK
Sbjct: 60  SELRHQLDINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLNPSKNREK 119



 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKR 254
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  ++    KD  VG+     R
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGETCSELR 63


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/59 (47%), Positives = 35/59 (59%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +   S   L YPIEHG V +WD ME+ W    +N LR  PE+H  LLTE+ L P  +RE
Sbjct: 78  SRSSSTHNLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTPPESRE 136



 Score = 35.9 bits (79), Expect = 0.023
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 173
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 31/71 (43%), Positives = 43/71 (60%)
 Frame = +2

Query: 209 GTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 388
           G++ L  RR   +Q  IL+   P + GIVT+WD ++ +W H F N L + P EHP+LL E
Sbjct: 72  GSQALNFRR---DQMEILS---PTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHPMLLAE 125

Query: 389 ASLNPKGNREK 421
             LN +  REK
Sbjct: 126 PPLNSQQQREK 136



 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/34 (70%), Positives = 31/34 (91%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVG 38


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/49 (48%), Positives = 33/49 (67%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           PI+ GIV++WD ++ IW H F + L + P EHP+LL E  LN +  REK
Sbjct: 94  PIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREK 142



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 38


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 236
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66



 Score = 29.1 bits (62), Expect = 2.6
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEASLNPKGNREK 421
           P +  +V  ++ ME I  + F       +  +HP+L+TE + NP  +R K
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSK 134


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLN-PKGNREKDD 427
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEA L+ P   R  D+
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDE 115



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.091
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -1

Query: 211 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 74
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score = 33.9 bits (74), Expect = 0.091
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEASLNPKGNREK 421
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PK  RE+
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQ 106



 Score = 28.3 bits (60), Expect = 4.5
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +3

Query: 399 TPRATERKMTQIMFETFN 452
           TP+A   ++ Q+MFETFN
Sbjct: 99  TPKAIREQLVQLMFETFN 116



 Score = 27.5 bits (58), Expect = 7.9
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGR 179
           ALVVD GS   KAG A  D +P  + PS + R
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR 34


>At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin;
           glycine-rich protein 16 (GRP16) PMID:11431566
          Length = 190

 Score = 31.1 bits (67), Expect = 0.64
 Identities = 20/46 (43%), Positives = 21/46 (45%)
 Frame = -1

Query: 589 PFGKMGHGLWKNTGSREVPARIPGGTDGRRTARSTGLNAKRTWRGV 452
           P G  G G      S   P    GG  GRRT RS G   +RTWR V
Sbjct: 134 PGGASGGGDKPGGASGGGPGGASGGAVGRRTWRSVG---RRTWRSV 176


>At1g59970.1 68414.m06755 matrixin family protein similar to
           SP|P29136 Metalloendoproteinase 1 precursor (EC
           3.4.24.-) (SMEP1) {Glycine max}; contains InterPro
           accession IPR001818: Matrixin
          Length = 360

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 1/36 (2%)
 Frame = -1

Query: 520 GGTDGRRTARSTGLNAKRTWRG-VLNVSNMIWVIFL 416
           GG+   R ++STG ++ R WRG ++++S++   IFL
Sbjct: 322 GGSKPSRESQSTGGDSVRRWRGWMISLSSIATCIFL 357


>At3g12650.1 68416.m01575 expressed protein
          Length = 238

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = -1

Query: 400 VEGSLSKQDWVFLGGDTQLIVEGMMPNL 317
           +EG   ++D   LG +T+ ++EGMM N+
Sbjct: 99  IEGPTVERDLSALGNETRQVLEGMMKNM 126


>At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to
           protodermal factor 1 [Arabidopsis thaliana]
           gi|4929130|gb|AAD33869
          Length = 306

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 25/94 (26%), Positives = 32/94 (34%)
 Frame = +3

Query: 333 PSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLPS 512
           P + +C SPP +        PS P  T    T     T +TP H      P       PS
Sbjct: 53  PPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPS 112

Query: 513 VPPGIRAGTSREPVFFHNPCPILPKGIPHFSPTP 614
            P      T   P    +P P  P    ++S  P
Sbjct: 113 HP-----STPSHPSTPSHPTPSHPPSGGYYSSPP 141


>At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to
           protodermal factor 1 [Arabidopsis thaliana]
           gi|4929130|gb|AAD33869
          Length = 306

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 25/94 (26%), Positives = 32/94 (34%)
 Frame = +3

Query: 333 PSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLPS 512
           P + +C SPP +        PS P  T    T     T +TP H      P       PS
Sbjct: 53  PPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPS 112

Query: 513 VPPGIRAGTSREPVFFHNPCPILPKGIPHFSPTP 614
            P      T   P    +P P  P    ++S  P
Sbjct: 113 HP-----STPSHPSTPSHPTPSHPPSGGYYSSPP 141


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 361
           E    L++KY + H I + W +  +IW       L+  P
Sbjct: 173 EALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP 211


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 361
           E    L++KY + H I + W +  +IW       L+  P
Sbjct: 173 EALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP 211


>At5g06610.1 68418.m00747 expressed protein contains Pfam profile
           PF04788: Protein of unknown function (DUF620)
          Length = 368

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -1

Query: 187 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 65
           WR  P +  + A+GA  P + AL   +PL+ ++  +S+  +
Sbjct: 167 WRYTPWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFV 207


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,900,585
Number of Sequences: 28952
Number of extensions: 424244
Number of successful extensions: 1310
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 1219
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1307
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1305036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).